Diaphorina citri psyllid: psy1296


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280---
EKIHPFQFFLAGGVGGALTVLVGHPFDTCKVRLQTANSKQPEYTASSFVGILYCTPIPLFYGRGEDSSFPILPSWWCRWSFNCFGMLDCVTKILQKEKIFGFYKGMGAPLVGVAPLNALNYFGYGTGLKFFTNEKNMGQLELWQYFLSGSLGGIVTAALVAPGERIKCLLQVQEGGLSNVYSGPVDVIRKLIQQHGLGSVFKGFSATLLRDVPAFGAYYAMYETVKHVFSGQGDSVIEVSDQTRKTTPLVGTITAGSMAGISYWIVVDSVDRRGESMYIVEAV
ccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHccccccccccHHHHHHHHHHHEEEHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHccHHHHHHHHHcccccccccccccHHHHHHHHHHHccccccccccHHHHcccccccEEHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHHccccHHHHHHccccccc
**IHPFQFFLAGGVGGALTVLVGHPFDTCKVRLQTANSKQPEYTASSFVGILYCTPIPLFYGRGEDSSFPILPSWWCRWSFNCFGMLDCVTKILQKEKIFGFYKGMGAPLVGVAPLNALNYFGYGTGLKFFTNEKNMGQLELWQYFLSGSLGGIVTAALVAPGERIKCLLQVQEGGLSNVYSGPVDVIRKLIQQHGLGSVFKGFSATLLRDVPAFGAYYAMYETVKHVFSGQGD**********KTTPLVGTITAGSMAGISYWIVVDSVDRRGESMYI****
xxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
EKIHPFQFFLAGGVGGALTVLVGHPFDTCKVRLQTANSKQPEYTASSFVGILYCTPIPLFYGRGEDSSFPILPSWWCRWSFNCFGMLDCVTKILQKEKIFGFYKGMGAPLVGVAPLNALNYFGYGTGLKFFTNEKNMGQLELWQYFLSGSLGGIVTAALVAPGERIKCLLQVQEGGLSNVYSGPVDVIRKLIQQHGLGSVFKGFSATLLRDVPAFGAYYAMYETVKHVFSGQGDSVIEVSDQTRKTTPLVGTITAGSMAGISYWIVVDSVDRRGESMYIVEAV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Mitochondrial carnitine/acylcarnitine carrier-like protein May transport carnitine or acylcarnitine from the cytosol to the mitochondrial matrix as an alternative or a complement to the succinate-producing glyoxylate cycle. Involved in the transition from the embryonic stage to the juvenile autotrophic stage.confidentQ93XM7
Congested-like trachea protein Putative mitochondrial carrier of unknown solute specificity. Required for gas-filling of the tracheal system at hatching time of the embryo and for normal epithelial morphogenesis of the wings.confidentQ9VQG4
Mitochondrial carnitine/acylcarnitine carrier protein Mediates the transport of acylcarnitines of different length across the mitochondrial inner membrane from the cytosol to the mitochondrial matrix for their oxidation by the mitochondrial fatty acid-oxidation pathway.confidentO43772

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044429 [CC]mitochondrial partprobableGO:0005737, GO:0005575, GO:0043231, GO:0044464, GO:0043229, GO:0005739, GO:0005622, GO:0044446, GO:0044444, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0015813 [BP]L-glutamate transportprobableGO:0006810, GO:0044765, GO:0015849, GO:0006811, GO:0006865, GO:0015711, GO:0071705, GO:0006820, GO:0015807, GO:0006835, GO:0008150, GO:0071702, GO:0015800, GO:0051234, GO:0051179, GO:0044699, GO:0046942
GO:0015810 [BP]aspartate transportprobableGO:0006810, GO:0044765, GO:0051234, GO:0015849, GO:0006811, GO:0006865, GO:0015711, GO:0071705, GO:0006820, GO:0006835, GO:0008150, GO:0071702, GO:0015800, GO:0015740, GO:0051179, GO:0044699, GO:0046942
GO:0015183 [MF]L-aspartate transmembrane transporter activityprobableGO:0022891, GO:0022892, GO:0005342, GO:0008514, GO:0005310, GO:0008509, GO:0015075, GO:0015172, GO:0022857, GO:0003674, GO:0015179, GO:0005215, GO:0015171, GO:0046943
GO:0044710 [BP]single-organism metabolic processprobableGO:0008150, GO:0008152
GO:0005313 [MF]L-glutamate transmembrane transporter activityprobableGO:0022891, GO:0022892, GO:0005342, GO:0008514, GO:0005310, GO:0008509, GO:0015075, GO:0015172, GO:0022857, GO:0003674, GO:0015179, GO:0005215, GO:0015171, GO:0046943
GO:0044237 [BP]cellular metabolic processprobableGO:0009987, GO:0008150, GO:0008152
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1OKC, chain A
Confidence level:very confident
Coverage over the Query: 18-41,79-225
View the alignment between query and template
View the model in PyMOL
Template: 1OKC, chain A
Confidence level:very confident
Coverage over the Query: 2-42,78-281
View the alignment between query and template
View the model in PyMOL