Diaphorina citri psyllid: psy12975

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-----
MTQLIINDDKKTSDTGDQTYSETTEPSITSKEPSVTTTEPSITSKEPFVTTTEPSITSKEPSVTTTEPSITSKEPSVTTTEPSITSKEPSVTTTEPSITSKEPSLTTTEPSITSKESSEITTEVSGTTTESCATTEPSTTASHHEKYSPGQHDTYRHVTFEPCARKVCVTPRPRRSGTASPPLVPKQIKAIGLDRDERHFRPMHT
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
***LI*N******************************************************************************************************************************************************************************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTQLIINDDKKTSDTGDQTYSETTEPSITSKEPSVTTTEPSITSKEPFVTTTEPSITSKEPSVTTTEPSITSKEPSVTTTEPSITSKEPSVTTTEPSITSKEPSLTTTEPSITSKESSEITTEVSGTTTESCATTEPSTTASHHEKYSPGQHDTYRHVTFEPCARKVCVTPRPRRSGTASPPLVPKQIKAIGLDRDERHFRPMHT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044425 [CC]membrane partprobableGO:0005575, GO:0016020
GO:0044421 [CC]extracellular region partprobableGO:0005575, GO:0005576
GO:0043231 [CC]intracellular membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0009986 [CC]cell surfaceprobableGO:0005575, GO:0044464, GO:0005623
GO:0009277 [CC]fungal-type cell wallprobableGO:0005618, GO:0044464, GO:0005623, GO:0030312, GO:0005575, GO:0071944

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!