Diaphorina citri psyllid: psy12978

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210

MEQQTCFAQWTSSVYKISFSFQYFMELDNVTESSMKILNVEFSSVNPQQAEGEDELKKRQLMELAIINGTYRDNNAKVLAAAVHILMLFPSSVSFSAACDEEWRRMAVAAAQETQRLLSPGMPGMATQLRTPTATPLGAPLILSPRIPAIPTSAASLLNGSPGGQLMNPADAHQLIYTPYADYANYAALTGSPLLTEYASADHSGGLYVR

cccccHHHHccccEEEEEEEEEEcccccHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHcccccccccccccccccccccccccccCCccccccccccccccccccccccccccccccccccccccccHHHHHHcccccccccccccccccccccc

****TCFAQWTSSVYKISFSFQYFMELDNVTESSMKILNVEFSSVNPQ*AE*EDELKKRQLMELAIINGTYRDNNAKVLAAAVHILMLFPSSVSFSAACDEEWRRMAVAA***************************GAPLILSPRI*******************MNPADAHQLIYTPYADYANYAALTGSPLLTEYASADH*G**Y**

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Protein held out wings	Required for integrin-mediated cell-adhesion in wing blade. Vital role in steroid regulation of muscle development and to control heart rate. Required during embryogenesis, in late stages of somatic muscle development, for myotube migration and during metamorphosis for muscle reorganization.	confident	O01367

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0007521 [BP]	muscle cell fate determination	probable	GO:0032502, GO:0045165, GO:0009987, GO:0048869, GO:0001709, GO:0044767, GO:0061061, GO:0044763, GO:0030154, GO:0008150, GO:0042693, GO:0042692, GO:0044699, GO:0048856
GO:0003730 [MF]	mRNA 3'-UTR binding	probable	GO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003729, GO:1901363, GO:0003723

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2BL5, chain A
Confidence level:very confident
Coverage over the Query: 26-80
View the alignment between query and template
View the model in PyMOL