Diaphorina citri psyllid: psy12986

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230

MSLGLLSEASNVVDIKSWPTILDTDDMPKKKLAALYRAPTAEMLAYLDFSVSTTGMLAGIKMSHAAVTSLCRSMKLACELYPSRHIALCLDPYCGLGFALWVLSSVYSGHHSILIPPSEVEVNPALWLSAVSQYRVRDTFCSYGVMELCTKGLSGSIPQLKARNIALGCVRTCVVVAEERPRIHLTSAFSKLFSALGLSPRAVSTSFGCRVNIAICLQLTKLELRSPSIH

ccccccccccccccccccccEEEccccccccccccccccccccEEEEEccccccccccEEEEcHHHHHHHHHHHHHHccccccccEEEEEccccccHHHHHHHHHHHccccEEEEcHHHHHHcHHHHHHHHHHcccEEEccccHHHHHHHcccccccccccccccccccccEEEEccccccccHHHHHHHHHHHccccccccccccccHHHHHHHHcccccccccccccc

********ASNVVDIKSWPTILDTDDMPKKKLAALYRAPTAEMLAYLDFSVSTTGMLAGIKMSHAAVTSLCRSMKLACELYPSRHIALCLDPYCGLGFALWVLSSVYSGHHSILIPPSEVEVNPALWLSAVSQYRVRDTFCSYGVMELCTKGLSGSIPQLKARNIALGCVRTCVVVAEERPRIHLTSAFSKLFSALGLSPRAVSTSFGCRVNIAICLQLTKL********

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Disco-interacting protein 2 homolog B		confident	Q9P265
Disco-interacting protein 2	May provide positional cues for axon pathfinding and patterning in the central nervous system.	confident	Q9W0S9

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0008152 [BP]	metabolic process	probable	GO:0008150
GO:0005634 [CC]	nucleus	probable	GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0008134 [MF]	transcription factor binding	probable	GO:0003674, GO:0005488, GO:0005515
GO:0003824 [MF]	catalytic activity	probable	GO:0003674

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3T5A, chain A
Confidence level:confident
Coverage over the Query: 37-219
View the alignment between query and template
View the model in PyMOL