Diaphorina citri psyllid: psy13005

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130
MVESTPSPTPSRANNGFVLYLASTIMFVVYLIWAFIPDSILYYFGLTYLPQKYWAIAVPIYGMVLLFVFVMFFYPCINMSLTPVRDSPNVMIDSFSLSDKKETVPGGIPSACDIPISTVCEMLYLKNKKL
ccccccccccccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHcccCECccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEcccccccccccccccccccccccHHHHHHHHHcccccc
************ANNGFVLYLASTIMFVVYLIWAFIPDSILYYFGLTYLPQKYWAIAVPIYGMVLLFVFVMFFYPCINMSLTPVRDSPNVMIDSFSLSD****VPGGIPSACDIPISTVCEMLYLK****
xxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVESTPSPTPSRANNGFVLYLASTIMFVVYLIWAFIPDSILYYFGLTYLPQKYWAIAVPIYGMVLLFVFVMFFYPCINMSLTPVRDSPNVMIDSFSLSDKKETVPGGIPSACDIPISTVCEMLYLKNKKL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Phosphatidylinositol N-acetylglucosaminyltransferase subunit P Part of the complex catalyzing the transfer of N-acetylglucosamine from UDP-N-acetylglucosamine to phosphatidylinositol, the first step of GPI biosynthesis.confidentQ5R946
Phosphatidylinositol N-acetylglucosaminyltransferase subunit P Part of the complex catalyzing the transfer of N-acetylglucosamine from UDP-N-acetylglucosamine to phosphatidylinositol, the first step of GPI biosynthesis.confidentQ9JHG1
Phosphatidylinositol N-acetylglucosaminyltransferase subunit P Part of the complex catalyzing the transfer of N-acetylglucosamine from UDP-N-acetylglucosamine to phosphatidylinositol, the first step of GPI biosynthesis.confidentP57054

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0017176 [MF]phosphatidylinositol N-acetylglucosaminyltransferase activityprobableGO:0003824, GO:0016740, GO:0003674, GO:0016757, GO:0016758, GO:0008375, GO:0008194
GO:0000506 [CC]glycosylphosphatidylinositol-N-acetylglucosaminyltransferase (GPI-GnT) complexprobableGO:0043234, GO:0005737, GO:0032991, GO:0005783, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044432, GO:0044444, GO:0005575, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005789 [CC]endoplasmic reticulum membraneprobableGO:0005737, GO:0005575, GO:0005783, GO:0044432, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0043231, GO:0044446, GO:0042175, GO:0044444, GO:0012505, GO:0044424, GO:0044425, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0031090
GO:0006501 [BP]C-terminal protein lipidationprobableGO:0018410, GO:0044249, GO:0042157, GO:0034645, GO:0042158, GO:0044267, GO:0044260, GO:0071704, GO:1901576, GO:0043687, GO:0009987, GO:0006464, GO:0009058, GO:0036211, GO:0008150, GO:0008152, GO:0006497, GO:0044238, GO:0019538, GO:0043412, GO:0044237, GO:0043170, GO:0009059
GO:0016254 [BP]preassembly of GPI anchor in ER membraneprobableGO:0006650, GO:0044249, GO:0042157, GO:0034645, GO:0042158, GO:0044255, GO:0006629, GO:0044267, GO:0044710, GO:0044260, GO:0090407, GO:0008150, GO:0071704, GO:0006505, GO:0006506, GO:0046467, GO:0006664, GO:0006644, GO:0006643, GO:1901576, GO:0009987, GO:0009247, GO:0006464, GO:0009058, GO:0045017, GO:0046488, GO:0008152, GO:0006661, GO:0046486, GO:0009059, GO:0008610, GO:0006497, GO:0044238, GO:0008654, GO:1901137, GO:1901135, GO:0043412, GO:0044237, GO:0043170, GO:0019538, GO:0006796, GO:0036211, GO:0006793, GO:0019637, GO:0046474

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.4.-.-Glycosyltransferases.probable
2.4.1.-Hexosyltransferases.probable
2.4.1.198Phosphatidylinositol N-acetylglucosaminyltransferase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3ARC, chain E
Confidence level:probable
Coverage over the Query: 52-89
View the alignment between query and template
View the model in PyMOL