Diaphorina citri psyllid: psy13020


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80-
MRKRHQVSLEQKNANIRFNPIITNEETLRISIEDMGFDARLPSTNDEATFTVDGMKCQSCVKKIEATIGEKPGVIAVKVSH
ccCEEEEEEcccCEEEEEccccccHHHHHHHHHHccccEEccccccEEEEEEcccccHHHHHHHHHHHccccccEEEEEcc
*RKRHQVSLEQKNANIRFNPIITNEETLRISIEDMGFDARLPSTNDEATFTVDGMKCQSCVKKIEATIGEKPGVIAVKVSH
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRKRHQVSLEQKNANIRFNPIITNEETLRISIEDMGFDARLPSTNDEATFTVDGMKCQSCVKKIEATIGEKPGVIAVKVSH

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005375 [MF]copper ion transmembrane transporter activityprobableGO:0022891, GO:0022890, GO:0022892, GO:0046915, GO:0005215, GO:0008324, GO:0015075, GO:0022857, GO:0003674, GO:0046873
GO:0005507 [MF]copper ion bindingprobableGO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0005768 [CC]endosomeprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0010038 [BP]response to metal ionprobableGO:0042221, GO:0050896, GO:0010035, GO:0008150
GO:0044459 [CC]plasma membrane partprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425
GO:0035434 [BP]copper ion transmembrane transportprobableGO:0006810, GO:0006812, GO:0006811, GO:0000041, GO:0051179, GO:0008150, GO:0034220, GO:0044765, GO:0030001, GO:0006825, GO:0044763, GO:0009987, GO:0051234, GO:0055085, GO:0044699
GO:0005802 [CC]trans-Golgi networkprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0031410 [CC]cytoplasmic vesicleprobableGO:0005737, GO:0031982, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043226

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2ROP, chain A
Confidence level:very confident
Coverage over the Query: 4-81
View the alignment between query and template
View the model in PyMOL