Psyllid ID: psy13020

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80-
MRKRHQVSLEQKNANIRFNPIITNEETLRISIEDMGFDARLPSTNDEATFTVDGMKCQSCVKKIEATIGEKPGVIAVKVSH
ccEEEEEEEcccEEEEEEccccccHHHHHHHHHHccccEEccccccEEEEEEcccccHHHHHHHHHHHccccccEEEEEcc
cccEEEEEEHcccEEEEEccccccHHHHHHHHHHccccEEccccccEEEEEEEcccHHHHHHHHHHHHcccccEEEEEEcc
mrkrhqvsleqknanirfnpiitneeTLRISIEdmgfdarlpstndeatftvdgmkcQSCVKKIEATIGEKPGVIAVKVSH
mrkrhqvsleqknanirfnpiitneETLRISIEDMGFDARLPSTNDEATFTVDGMKCQSCVKKieatigekpgviavkvsh
MRKRHQVSLEQKNANIRFNPIITNEETLRISIEDMGFDARLPSTNDEATFTVDGMKCQSCVKKIEATIGEKPGVIAVKVSH
***************IRFNPIITNEETLRISIEDMGFDARLPSTNDEATFTVDGMKCQSCVKKIEATIGEKPGVIA*****
*RKRHQVSLEQKNANIRFNPIITNEETLRISIEDMGFDARLPSTNDEATFTVDGMKCQSCVKKIEATIGEKPGVIAVKVSH
********LEQKNANIRFNPIITNEETLRISIEDMGFDARLPSTNDEATFTVDGMKCQSCVKKIEATIGEKPGVIAVKVSH
*RKRHQVSLEQKNANIRFNPIITNEETLRISIEDMGFDARLPSTNDEATFTVDGMKCQSCVKKIEATIGEKPGVIAVKVS*
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRKRHQVSLEQKNANIRFNPIITNEETLRISIEDMGFDARLPSTNDEATFTVDGMKCQSCVKKIEATIGEKPGVIAVKVSH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query81 2.2.26 [Sep-21-2011]
Q64446 1462 Copper-transporting ATPas yes N/A 0.925 0.051 0.397 3e-09
Q64535 1451 Copper-transporting ATPas yes N/A 0.925 0.051 0.397 5e-09
Q9XT50 1505 Copper-transporting ATPas N/A N/A 0.925 0.049 0.375 1e-08
Q64430 1491 Copper-transporting ATPas no N/A 0.962 0.052 0.324 3e-08
Q9S7J8 1001 Copper-transporting ATPas yes N/A 0.876 0.070 0.368 1e-07
P35670 1465 Copper-transporting ATPas yes N/A 0.925 0.051 0.352 6e-07
Q04656 1500 Copper-transporting ATPas no N/A 0.962 0.052 0.282 8e-07
P49015 1476 Copper-transporting ATPas no N/A 0.962 0.052 0.324 1e-06
P70705 1492 Copper-transporting ATPas no N/A 0.962 0.052 0.321 1e-06
Q9SH30 995 Putative copper-transport no N/A 0.975 0.079 0.317 0.0001
>sp|Q64446|ATP7B_MOUSE Copper-transporting ATPase 2 OS=Mus musculus GN=Atp7b PE=1 SV=2 Back     alignment and function desciption
 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 35/88 (39%), Positives = 49/88 (55%), Gaps = 13/88 (14%)

Query: 6   QVSLEQKNANIRFNPIITNEETLRISIEDMGFD--------ARLPSTNDEAT-----FTV 52
           +VSLEQ +A +R+ P + N + + + IEDMGF+        A  PS +  A        V
Sbjct: 100 KVSLEQGSATVRYVPSVMNLQQICLQIEDMGFEASAAEGKAASWPSRSSPAQEAVVKLRV 159

Query: 53  DGMKCQSCVKKIEATIGEKPGVIAVKVS 80
           +GM CQSCV  IE  I +  GV+ +KVS
Sbjct: 160 EGMTCQSCVSSIEGKIRKLQGVVRIKVS 187
Involved in the export of copper out of the cells, such as the efflux of hepatic copper into the bile.
Mus musculus (taxid: 10090)
EC: 3EC: .EC: 6EC: .EC: 3EC: .EC: 4
>sp|Q64535|ATP7B_RAT Copper-transporting ATPase 2 OS=Rattus norvegicus GN=Atp7b PE=2 SV=1 Back     alignment and function description
>sp|Q9XT50|ATP7B_SHEEP Copper-transporting ATPase 2 OS=Ovis aries GN=ATP7B PE=2 SV=1 Back     alignment and function description
>sp|Q64430|ATP7A_MOUSE Copper-transporting ATPase 1 OS=Mus musculus GN=Atp7a PE=1 SV=3 Back     alignment and function description
>sp|Q9S7J8|HMA7_ARATH Copper-transporting ATPase RAN1 OS=Arabidopsis thaliana GN=RAN1 PE=1 SV=1 Back     alignment and function description
>sp|P35670|ATP7B_HUMAN Copper-transporting ATPase 2 OS=Homo sapiens GN=ATP7B PE=1 SV=4 Back     alignment and function description
>sp|Q04656|ATP7A_HUMAN Copper-transporting ATPase 1 OS=Homo sapiens GN=ATP7A PE=1 SV=3 Back     alignment and function description
>sp|P49015|ATP7A_CRIGR Copper-transporting ATPase 1 (Fragment) OS=Cricetulus griseus GN=ATP7A PE=2 SV=1 Back     alignment and function description
>sp|P70705|ATP7A_RAT Copper-transporting ATPase 1 OS=Rattus norvegicus GN=Atp7a PE=1 SV=1 Back     alignment and function description
>sp|Q9SH30|HMA5_ARATH Putative copper-transporting ATPase HMA5 OS=Arabidopsis thaliana GN=HMA5 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query81
405962778 1434 Copper-transporting ATPase 1 [Crassostre 0.913 0.051 0.5 2e-11
405950330 1542 Copper-transporting ATPase 1 [Crassostre 0.913 0.047 0.5 2e-11
260833356 1683 hypothetical protein BRAFLDRAFT_63720 [B 0.876 0.042 0.44 3e-10
334330582 1460 PREDICTED: copper-transporting ATPase 2 0.925 0.051 0.420 9e-10
395520999 1597 PREDICTED: LOW QUALITY PROTEIN: copper-t 0.925 0.046 0.420 1e-09
390357245 1361 PREDICTED: copper-transporting ATPase 2- 0.925 0.055 0.409 2e-09
156401127 1172 predicted protein [Nematostella vectensi 0.962 0.066 0.405 2e-09
443709807 1272 hypothetical protein CAPTEDRAFT_32189, p 0.925 0.058 0.423 5e-09
348518171 1281 PREDICTED: copper-transporting ATPase 2, 0.925 0.058 0.469 1e-08
326668465 1278 PREDICTED: copper-transporting ATPase 2 0.913 0.057 0.421 1e-08
>gi|405962778|gb|EKC28422.1| Copper-transporting ATPase 1 [Crassostrea gigas] Back     alignment and taxonomy information
 Score = 73.2 bits (178), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 39/78 (50%), Positives = 54/78 (69%), Gaps = 4/78 (5%)

Query: 7   VSLEQKNANIRFNPIITNEETLRISIEDMGFDARLPS-TNDEATFT---VDGMKCQSCVK 62
           VSLE+K A ++FNP   + E +  +I+DMGF+A + S T D+   T   V+GM CQSCVK
Sbjct: 91  VSLEKKQAYVQFNPGKVSAENIAAAIDDMGFEASVHSITRDKGLTTKIGVEGMTCQSCVK 150

Query: 63  KIEATIGEKPGVIAVKVS 80
            IE+T+G KPGV  ++VS
Sbjct: 151 SIESTMGSKPGVREIRVS 168

Source: Crassostrea gigas

Species: Crassostrea gigas

Genus: Crassostrea

Family: Ostreidae

Order: Ostreoida

Class: Bivalvia

Phylum: Mollusca

Superkingdom: Eukaryota
>gi|405950330|gb|EKC18325.1| Copper-transporting ATPase 1 [Crassostrea gigas] Back     alignment and taxonomy information
>gi|260833356|ref|XP_002611623.1| hypothetical protein BRAFLDRAFT_63720 [Branchiostoma floridae] gi|229296994|gb|EEN67633.1| hypothetical protein BRAFLDRAFT_63720 [Branchiostoma floridae] Back     alignment and taxonomy information
>gi|334330582|ref|XP_001378265.2| PREDICTED: copper-transporting ATPase 2 [Monodelphis domestica] Back     alignment and taxonomy information
>gi|395520999|ref|XP_003764609.1| PREDICTED: LOW QUALITY PROTEIN: copper-transporting ATPase 2 [Sarcophilus harrisii] Back     alignment and taxonomy information
>gi|390357245|ref|XP_797382.3| PREDICTED: copper-transporting ATPase 2-like [Strongylocentrotus purpuratus] Back     alignment and taxonomy information
>gi|156401127|ref|XP_001639143.1| predicted protein [Nematostella vectensis] gi|156226269|gb|EDO47080.1| predicted protein [Nematostella vectensis] Back     alignment and taxonomy information
>gi|443709807|gb|ELU04312.1| hypothetical protein CAPTEDRAFT_32189, partial [Capitella teleta] Back     alignment and taxonomy information
>gi|348518171|ref|XP_003446605.1| PREDICTED: copper-transporting ATPase 2, partial [Oreochromis niloticus] Back     alignment and taxonomy information
>gi|326668465|ref|XP_684415.4| PREDICTED: copper-transporting ATPase 2 [Danio rerio] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query81
MGI|MGI:99400 1491 Atp7a "ATPase, Cu++ transporti 0.543 0.029 0.5 6.2e-09
UNIPROTKB|Q04656 1500 ATP7A "Copper-transporting ATP 0.543 0.029 0.5 6.2e-09
UNIPROTKB|F1PK99 1499 ATP7A "Uncharacterized protein 0.543 0.029 0.477 1e-08
ZFIN|ZDB-GENE-110407-7 1364 si:dkey-276l13.3 "si:dkey-276l 0.925 0.054 0.458 1.4e-08
UNIPROTKB|J9NW28 545 ATP7B "Uncharacterized protein 0.925 0.137 0.397 2.9e-07
MGI|MGI:103297 1462 Atp7b "ATPase, Cu++ transporti 0.925 0.051 0.397 8.6e-08
UNIPROTKB|F6XIH0 528 ATP7B "WND/140 kDa" [Homo sapi 0.925 0.142 0.375 4.2e-06
UNIPROTKB|F1M5X3 1434 Atp7b "Copper-transporting ATP 0.925 0.052 0.397 1.4e-07
RGD|2180 1451 Atp7b "ATPase, Cu++ transporti 0.925 0.051 0.397 1.4e-07
UNIPROTKB|Q9QUG4 1452 Atp7b "Copper-transporting ATP 0.925 0.051 0.397 1.4e-07
MGI|MGI:99400 Atp7a "ATPase, Cu++ transporting, alpha polypeptide" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
 Score = 109 (43.4 bits), Expect = 6.2e-09, Sum P(2) = 6.2e-09
 Identities = 22/44 (50%), Positives = 28/44 (63%)

Query:     3 KRHQVSLEQKNANIRFNPIITNEETLRISIEDMGFDARLPSTND 46
             K   VSL      I F+P++T+ ETLR +IEDMGFDA LP   +
Sbjct:   406 KSIHVSLANSTGTIEFDPLLTSPETLREAIEDMGFDAALPDMKE 449
GO:0000166 "nucleotide binding" evidence=IEA
GO:0001568 "blood vessel development" evidence=IMP
GO:0001836 "release of cytochrome c from mitochondria" evidence=IMP
GO:0001974 "blood vessel remodeling" evidence=IMP
GO:0002082 "regulation of oxidative phosphorylation" evidence=IMP
GO:0004008 "copper-exporting ATPase activity" evidence=IDA
GO:0005375 "copper ion transmembrane transporter activity" evidence=IMP
GO:0005507 "copper ion binding" evidence=ISO
GO:0005515 "protein binding" evidence=IPI
GO:0005524 "ATP binding" evidence=IEA
GO:0005770 "late endosome" evidence=ISO
GO:0005783 "endoplasmic reticulum" evidence=ISO
GO:0005794 "Golgi apparatus" evidence=ISO;IDA
GO:0005802 "trans-Golgi network" evidence=ISO;IDA
GO:0005886 "plasma membrane" evidence=ISO;IDA
GO:0006200 "ATP catabolic process" evidence=IDA
GO:0006568 "tryptophan metabolic process" evidence=IMP
GO:0006570 "tyrosine metabolic process" evidence=IMP
GO:0006584 "catecholamine metabolic process" evidence=IMP
GO:0006810 "transport" evidence=IEA
GO:0006811 "ion transport" evidence=IEA
GO:0006812 "cation transport" evidence=IEA
GO:0006825 "copper ion transport" evidence=ISO;IDA;IMP
GO:0006878 "cellular copper ion homeostasis" evidence=ISO;IGI;IMP
GO:0007005 "mitochondrion organization" evidence=IMP
GO:0007626 "locomotory behavior" evidence=IMP
GO:0010273 "detoxification of copper ion" evidence=IMP
GO:0010468 "regulation of gene expression" evidence=IMP
GO:0015677 "copper ion import" evidence=IMP
GO:0016020 "membrane" evidence=IDA
GO:0016021 "integral to membrane" evidence=ISO
GO:0016323 "basolateral plasma membrane" evidence=ISO
GO:0016532 "superoxide dismutase copper chaperone activity" evidence=IDA
GO:0016787 "hydrolase activity" evidence=IEA
GO:0018205 "peptidyl-lysine modification" evidence=IMP
GO:0019430 "removal of superoxide radicals" evidence=IMP
GO:0019829 "cation-transporting ATPase activity" evidence=IEA
GO:0021702 "cerebellar Purkinje cell differentiation" evidence=IMP
GO:0021860 "pyramidal neuron development" evidence=IMP
GO:0021954 "central nervous system neuron development" evidence=IMP
GO:0030001 "metal ion transport" evidence=IEA
GO:0030140 "trans-Golgi network transport vesicle" evidence=ISO
GO:0030141 "secretory granule" evidence=ISO
GO:0030198 "extracellular matrix organization" evidence=IMP
GO:0030199 "collagen fibril organization" evidence=IMP
GO:0031069 "hair follicle morphogenesis" evidence=IMP
GO:0031410 "cytoplasmic vesicle" evidence=IDA
GO:0031526 "brush border membrane" evidence=ISO
GO:0032767 "copper-dependent protein binding" evidence=ISO
GO:0035137 "hindlimb morphogenesis" evidence=IMP
GO:0042093 "T-helper cell differentiation" evidence=IMP
GO:0042414 "epinephrine metabolic process" evidence=IMP
GO:0042415 "norepinephrine metabolic process" evidence=IMP
GO:0042417 "dopamine metabolic process" evidence=IMP
GO:0042421 "norepinephrine biosynthetic process" evidence=IMP
GO:0042428 "serotonin metabolic process" evidence=IMP
GO:0043005 "neuron projection" evidence=IDA
GO:0043025 "neuronal cell body" evidence=IDA
GO:0043085 "positive regulation of catalytic activity" evidence=IMP
GO:0043473 "pigmentation" evidence=IMP
GO:0043524 "negative regulation of neuron apoptotic process" evidence=IMP
GO:0043588 "skin development" evidence=IMP
GO:0046034 "ATP metabolic process" evidence=IMP
GO:0046688 "response to copper ion" evidence=ISO
GO:0046872 "metal ion binding" evidence=IEA
GO:0048251 "elastic fiber assembly" evidence=IMP
GO:0048286 "lung alveolus development" evidence=IMP
GO:0048471 "perinuclear region of cytoplasm" evidence=ISO
GO:0048553 "negative regulation of metalloenzyme activity" evidence=IMP
GO:0048554 "positive regulation of metalloenzyme activity" evidence=IMP
GO:0048812 "neuron projection morphogenesis" evidence=IMP
GO:0048813 "dendrite morphogenesis" evidence=IMP
GO:0051216 "cartilage development" evidence=IMP
GO:0051353 "positive regulation of oxidoreductase activity" evidence=ISO
GO:0051542 "elastin biosynthetic process" evidence=IMP
GO:0060003 "copper ion export" evidence=IDA;IMP
UNIPROTKB|Q04656 ATP7A "Copper-transporting ATPase 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1PK99 ATP7A "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-110407-7 si:dkey-276l13.3 "si:dkey-276l13.3" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|J9NW28 ATP7B "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:103297 Atp7b "ATPase, Cu++ transporting, beta polypeptide" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F6XIH0 ATP7B "WND/140 kDa" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1M5X3 Atp7b "Copper-transporting ATPase 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
RGD|2180 Atp7b "ATPase, Cu++ transporting, beta polypeptide" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q9QUG4 Atp7b "Copper-transporting ATPase 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query81
cd0037163 cd00371, HMA, Heavy-metal-associated domain (HMA) 5e-08
pfam0040362 pfam00403, HMA, Heavy-metal-associated domain 9e-07
TIGR0000366 TIGR00003, TIGR00003, copper ion binding protein 1e-06
COG260871 COG2608, CopZ, Copper chaperone [Inorganic ion tra 6e-06
COG2217 713 COG2217, ZntA, Cation transport ATPase [Inorganic 2e-05
PRK11033 741 PRK11033, zntA, zinc/cadmium/mercury/lead-transpor 1e-04
>gnl|CDD|238219 cd00371, HMA, Heavy-metal-associated domain (HMA) is a conserved domain of approximately 30 amino acid residues found in a number of proteins that transport or detoxify heavy metals, for example, the CPx-type heavy metal ATPases and copper chaperones Back     alignment and domain information 
 Score = 44.5 bits (106), Expect = 5e-08
 Identities = 14/32 (43%), Positives = 20/32 (62%)

Query: 49 TFTVDGMKCQSCVKKIEATIGEKPGVIAVKVS 80
            +V+GM C  CV KIE  + + PGV +V+V 
Sbjct: 1  ELSVEGMTCAGCVSKIEKALEKLPGVESVEVD 32

HMA domain contains two cysteine residues that are important in binding and transfer of metal ions, such as copper, cadmium, cobalt and zinc. In the case of copper, stoichiometry of binding is one Cu+ ion per binding domain. Repeats of the HMA domain in copper chaperone has been associated with Menkes/Wilson disease due to binding of multiple copper ions. Length = 63
>gnl|CDD|215902 pfam00403, HMA, Heavy-metal-associated domain Back     alignment and domain information
>gnl|CDD|188014 TIGR00003, TIGR00003, copper ion binding protein Back     alignment and domain information
>gnl|CDD|225328 COG2608, CopZ, Copper chaperone [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|225127 COG2217, ZntA, Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|236827 PRK11033, zntA, zinc/cadmium/mercury/lead-transporting ATPase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 81
KOG0207|consensus 951 98.99
PF0040362 HMA: Heavy-metal-associated domain; InterPro: IPR0 98.98
KOG0207|consensus 951 98.84
COG260871 CopZ Copper chaperone [Inorganic ion transport and 98.82
COG2217 713 ZntA Cation transport ATPase [Inorganic ion transp 97.98
PRK10671 834 copA copper exporting ATPase; Provisional 97.96
PRK10671 834 copA copper exporting ATPase; Provisional 97.82
PF0040362 HMA: Heavy-metal-associated domain; InterPro: IPR0 97.75
TIGR0000368 copper ion binding protein. This model describes a 97.22
COG260871 CopZ Copper chaperone [Inorganic ion transport and 97.2
PLN02957 238 copper, zinc superoxide dismutase 96.88
KOG4656|consensus 247 96.85
KOG1603|consensus73 96.85
PRK11033 741 zntA zinc/cadmium/mercury/lead-transporting ATPase 96.7
TIGR0205292 MerP mercuric transport protein periplasmic compon 89.64
COG2217 713 ZntA Cation transport ATPase [Inorganic ion transp 85.16
PRK13748 561 putative mercuric reductase; Provisional 84.36
cd0037163 HMA Heavy-metal-associated domain (HMA) is a conse 82.2
>KOG0207|consensus Back     alignment and domain information 
Probab=98.99  E-value=4.2e-09  Score=71.31  Aligned_cols=78  Identities=38%  Similarity=0.647  Sum_probs=68.1

Q ss_pred             CceEEEEecCCeEEEEEcCCCCCHHHHHHHHHhcCCcccCCCC----CceEEEEeccccchhHHHHHHHHhcCCCCeeEE
Q psy13020          2 RKRHQVSLEQKNANIRFNPIITNEETLRISIEDMGFDARLPST----NDEATFTVDGMKCQSCVKKIEATIGEKPGVIAV   77 (81)
Q Consensus         2 ~~~~~v~~~~~~~~v~~~~~~~~~~~i~~~i~~~g~~~~~~~~----~~~~~~~i~g~~c~~C~~~i~~~l~~~~gv~~~   77 (81)
                      +++..+++.++++.+.|+ ...+++.+.+.+++.||++.....    ..+..+++.||+|.+|...+++.+++.+|+..+
T Consensus        22 ~~~i~vsl~~~~~~v~~~-~~~~~~~i~~~ied~gf~~~~~~~~~~~~~~~~l~v~GmtC~scv~~i~~~l~~~~gv~~~  100 (951)
T KOG0207|consen   22 VQKIEVSLAQKRANVSYD-NIVSPESIKETIEDMGFEASLLSDSEITASKCYLSVNGMTCASCVATIERNLRKIEGVESA  100 (951)
T ss_pred             ceeEEEEeccccceEEEe-eccCHHHHHHHhhcccceeeecccCccccceeEEEecCceeHHHHHHHHHHhhccCCcceE
Confidence            467889999999999999 778999999999999999865432    246789999999999999999999999999887


Q ss_pred             EEe
Q psy13020         78 KVS   80 (81)
Q Consensus        78 ~~~   80 (81)
                      .+.
T Consensus       101 ~va  103 (951)
T KOG0207|consen  101 VVA  103 (951)
T ss_pred             EEE
Confidence            654

>PF00403 HMA: Heavy-metal-associated domain; InterPro: IPR006121 Proteins that transport heavy metals in micro-organisms and mammals share similarities in their sequences and structures Back     alignment and domain information
>KOG0207|consensus Back     alignment and domain information
>COG2608 CopZ Copper chaperone [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG2217 ZntA Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10671 copA copper exporting ATPase; Provisional Back     alignment and domain information
>PRK10671 copA copper exporting ATPase; Provisional Back     alignment and domain information
>PF00403 HMA: Heavy-metal-associated domain; InterPro: IPR006121 Proteins that transport heavy metals in micro-organisms and mammals share similarities in their sequences and structures Back     alignment and domain information
>TIGR00003 copper ion binding protein Back     alignment and domain information
>COG2608 CopZ Copper chaperone [Inorganic ion transport and metabolism] Back     alignment and domain information
>PLN02957 copper, zinc superoxide dismutase Back     alignment and domain information
>KOG4656|consensus Back     alignment and domain information
>KOG1603|consensus Back     alignment and domain information
>PRK11033 zntA zinc/cadmium/mercury/lead-transporting ATPase; Provisional Back     alignment and domain information
>TIGR02052 MerP mercuric transport protein periplasmic component Back     alignment and domain information
>COG2217 ZntA Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>cd00371 HMA Heavy-metal-associated domain (HMA) is a conserved domain of approximately 30 amino acid residues found in a number of proteins that transport or detoxify heavy metals, for example, the CPx-type heavy metal ATPases and copper chaperones Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query81
1aw0_A72 Fourth Metal-Binding Domain Of The Menkes Copper- T 2e-06
1aw0_A72 Fourth Metal-Binding Domain Of The Menkes Copper- T 7e-05
1kvi_A79 Solution Structure Of The Reduced Form Of The First 1e-04
2k1r_A73 The Solution Nmr Structure Of The Complex Between M 2e-04
3cjk_B75 Crystal Structure Of The Adduct Hah1-Cd(Ii)-Mnk1 Le 2e-04
2rop_A202 Solution Structure Of Domains 3 And 4 Of Human Atp7 4e-04
2qif_A69 Crystal Structure Of A Metallochaperone With A Tetr 5e-04
1p8g_A73 The Solution Structure Of Apo Copz From Bacillus Su 5e-04
2ew9_A149 Solution Structure Of Apowln5-6 Length = 149 6e-04
>pdb|1AW0|A Chain A, Fourth Metal-Binding Domain Of The Menkes Copper- Transporting Atpase, Nmr, 20 Structures Length = 72 Back     alignment and structure 
Iteration: 1

 Score = 47.4 bits (111), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 28/39 (71%)
Query: 3  KRHQVSLEQKNANIRFNPIITNEETLRISIEDMGFDARL 41
          K  +VSL   N  + ++P++T+ ETLR +IEDMGFDA L
Sbjct: 32 KSIRVSLANSNGTVEYDPLLTSPETLRGAIEDMGFDATL 70
>pdb|1AW0|A Chain A, Fourth Metal-Binding Domain Of The Menkes Copper- Transporting Atpase, Nmr, 20 Structures Length = 72 Back     alignment and structure
>pdb|1KVI|A Chain A, Solution Structure Of The Reduced Form Of The First Heavy Metal Binding Motif Of The Menkes Protein Length = 79 Back     alignment and structure
>pdb|2K1R|A Chain A, The Solution Nmr Structure Of The Complex Between Mnk1 And Hah1 Mediated By Cu(I) Length = 73 Back     alignment and structure
>pdb|3CJK|B Chain B, Crystal Structure Of The Adduct Hah1-Cd(Ii)-Mnk1 Length = 75 Back     alignment and structure
>pdb|2ROP|A Chain A, Solution Structure Of Domains 3 And 4 Of Human Atp7b Length = 202 Back     alignment and structure
>pdb|2QIF|A Chain A, Crystal Structure Of A Metallochaperone With A Tetranuclear Cu(I) Cluster Length = 69 Back     alignment and structure
>pdb|1P8G|A Chain A, The Solution Structure Of Apo Copz From Bacillus Subtilis Length = 73 Back     alignment and structure
>pdb|2EW9|A Chain A, Solution Structure Of Apowln5-6 Length = 149 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query81
2ew9_A149 Copper-transporting ATPase 2; copper trafficking, 1e-18
2ew9_A 149 Copper-transporting ATPase 2; copper trafficking, 9e-08
2ew9_A149 Copper-transporting ATPase 2; copper trafficking, 1e-04
1p6t_A151 Potential copper-transporting ATPase; COPA, P-type 6e-17
1p6t_A 151 Potential copper-transporting ATPase; COPA, P-type 1e-07
1p6t_A151 Potential copper-transporting ATPase; COPA, P-type 4e-05
2rop_A202 Copper-transporting ATPase 2; wilson protein, mobi 1e-12
2rop_A 202 Copper-transporting ATPase 2; wilson protein, mobi 1e-10
2rop_A202 Copper-transporting ATPase 2; wilson protein, mobi 1e-06
2g9o_A90 Copper-transporting ATPase 1; menkes disease, solu 5e-10
2g9o_A90 Copper-transporting ATPase 1; menkes disease, solu 4e-06
1yg0_A66 COP associated protein; open-faced beta-sandwich, 3e-09
1aw0_A72 Menkes copper-transporting ATPase; copper-binding 6e-09
1aw0_A72 Menkes copper-transporting ATPase; copper-binding 3e-07
1kvi_A79 Copper-transporting ATPase 1; menkes, Cu-protein, 7e-09
1kvi_A79 Copper-transporting ATPase 1; menkes, Cu-protein, 2e-08
1q8l_A84 Copper-transporting ATPase 1; metal binding protei 9e-09
1q8l_A84 Copper-transporting ATPase 1; metal binding protei 2e-06
3cjk_B75 Copper-transporting ATPase 1; HAH1, ATP7B, menkes 1e-08
3cjk_B75 Copper-transporting ATPase 1; HAH1, ATP7B, menkes 2e-07
2qif_A69 Copper chaperone COPZ; tetranuclear Cu(I) cluster; 1e-08
2qif_A69 Copper chaperone COPZ; tetranuclear Cu(I) cluster; 6e-05
2l3m_A71 Copper-ION-binding protein; structural genomics, c 2e-08
2l3m_A71 Copper-ION-binding protein; structural genomics, c 2e-05
1fvq_A72 Copper-transporting ATPase; APO-CCC2A, hydrolase; 2e-08
1fvq_A72 Copper-transporting ATPase; APO-CCC2A, hydrolase; 3e-05
2kkh_A95 Putative heavy metal transporter; zinc transport, 5e-08
2kkh_A95 Putative heavy metal transporter; zinc transport, 2e-05
1cpz_A68 Protein (COPZ); copper chaperone, metal transport, 2e-07
1cpz_A68 Protein (COPZ); copper chaperone, metal transport, 4e-05
3dxs_X74 Copper-transporting ATPase RAN1; CXXC motif, ferre 2e-07
3dxs_X74 Copper-transporting ATPase RAN1; CXXC motif, ferre 2e-05
2k2p_A85 Uncharacterized protein ATU1203; putative metal-bi 3e-07
1mwy_A73 ZNTA; open-faced beta-sandwich fold, beta-alpha-be 3e-07
1osd_A72 MERP, hypothetical protein MERP; mercury resistanc 3e-07
1osd_A72 MERP, hypothetical protein MERP; mercury resistanc 2e-05
2roe_A66 Heavy metal binding protein; NMR {Thermus thermoph 3e-07
1opz_A76 Potential copper-transporting ATPase; mutation, fo 3e-07
2ldi_A71 Zinc-transporting ATPase; metal homeostasis, metal 4e-07
2ldi_A71 Zinc-transporting ATPase; metal homeostasis, metal 1e-04
3j09_A 723 COPA, copper-exporting P-type ATPase A; copper tra 4e-07
1y3j_A77 Copper-transporting ATPase 1; ferrodoxin-like fold 4e-07
1y3j_A77 Copper-transporting ATPase 1; ferrodoxin-like fold 2e-05
1yjr_A75 Copper-transporting ATPase 1; metallochaperone, pr 7e-07
1yjr_A75 Copper-transporting ATPase 1; metallochaperone, pr 2e-04
2ofg_X111 Zinc-transporting ATPase; ferredoxin-like fold, be 8e-07
2ofg_X111 Zinc-transporting ATPase; ferredoxin-like fold, be 6e-05
2kt2_A69 Mercuric reductase; nmera, MERA, HMA domain, mercu 2e-06
1jww_A80 Potential copper-transporting ATPase; beta-alpha-b 2e-06
2aj0_A71 Probable cadmium-transporting ATPase; ferrodoxin-l 2e-06
2xmw_A71 PACS-N, cation-transporting ATPase PACS; hydrolase 2e-06
2xmm_A64 SSR2857 protein, ATX1; metal transport, copper hom 4e-06
3fry_A73 Probable copper-exporting P-type ATPase A; transpo 3e-05
2kyz_A67 Heavy metal binding protein; structural genomics, 3e-04
1jk9_B 249 CCS, copper chaperone for superoxide dismutase; pr 4e-04
2crl_A98 Copper chaperone for superoxide dismutase; SOD1, f 5e-04
1qup_A 222 Superoxide dismutase 1 copper chaperone; two domai 7e-04
>2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} Length = 149 Back     alignment and structure
 Score = 73.5 bits (181), Expect = 1e-18
 Identities = 21/79 (26%), Positives = 36/79 (45%), Gaps = 4/79 (5%)

Query: 6   QVSLEQKNANIRFNPIITNEETLRISIEDMGFDARLPSTND----EATFTVDGMKCQSCV 61
            V+L    A I+++P +     +   I+D+GF+A +             T+ GM C SCV
Sbjct: 36  LVALMAGKAEIKYDPEVIQPLEIAQFIQDLGFEAAVMEDYAGSDGNIELTITGMTCASCV 95

Query: 62  KKIEATIGEKPGVIAVKVS 80
             IE+ +    G+    V+
Sbjct: 96  HNIESKLTRTNGITYASVA 114
>2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} Length = 149 Back     alignment and structure
>2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} Length = 149 Back     alignment and structure
>1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} SCOP: d.58.17.1 d.58.17.1 PDB: 2rml_A Length = 151 Back     alignment and structure
>1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} SCOP: d.58.17.1 d.58.17.1 PDB: 2rml_A Length = 151 Back     alignment and structure
>1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} SCOP: d.58.17.1 d.58.17.1 PDB: 2rml_A Length = 151 Back     alignment and structure
>2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens} Length = 202 Back     alignment and structure
>2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens} Length = 202 Back     alignment and structure
>2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens} Length = 202 Back     alignment and structure
>2g9o_A Copper-transporting ATPase 1; menkes disease, solution structure, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} PDB: 2ga7_A Length = 90 Back     alignment and structure
>2g9o_A Copper-transporting ATPase 1; menkes disease, solution structure, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} PDB: 2ga7_A Length = 90 Back     alignment and structure
>1yg0_A COP associated protein; open-faced beta-sandwich, missing C-terminal beta-sheet, Met transport; NMR {Helicobacter pylori} Length = 66 Back     alignment and structure
>1aw0_A Menkes copper-transporting ATPase; copper-binding domain, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 2aw0_A Length = 72 Back     alignment and structure
>1aw0_A Menkes copper-transporting ATPase; copper-binding domain, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 2aw0_A Length = 72 Back     alignment and structure
>1kvi_A Copper-transporting ATPase 1; menkes, Cu-protein, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1kvj_A Length = 79 Back     alignment and structure
>1kvi_A Copper-transporting ATPase 1; menkes, Cu-protein, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1kvj_A Length = 79 Back     alignment and structure
>1q8l_A Copper-transporting ATPase 1; metal binding protein; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1s6o_A 1s6u_A Length = 84 Back     alignment and structure
>1q8l_A Copper-transporting ATPase 1; metal binding protein; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1s6o_A 1s6u_A Length = 84 Back     alignment and structure
>3cjk_B Copper-transporting ATPase 1; HAH1, ATP7B, menkes disease, metal homeostasis, chaperone, ION transport, metal- binding, alternative splicing; 1.80A {Homo sapiens} PDB: 2k1r_A Length = 75 Back     alignment and structure
>3cjk_B Copper-transporting ATPase 1; HAH1, ATP7B, menkes disease, metal homeostasis, chaperone, ION transport, metal- binding, alternative splicing; 1.80A {Homo sapiens} PDB: 2k1r_A Length = 75 Back     alignment and structure
>2qif_A Copper chaperone COPZ; tetranuclear Cu(I) cluster; 1.50A {Bacillus subtilis} SCOP: d.58.17.1 PDB: 3i9z_A 1k0v_A 1p8g_A Length = 69 Back     alignment and structure
>2qif_A Copper chaperone COPZ; tetranuclear Cu(I) cluster; 1.50A {Bacillus subtilis} SCOP: d.58.17.1 PDB: 3i9z_A 1k0v_A 1p8g_A Length = 69 Back     alignment and structure
>2l3m_A Copper-ION-binding protein; structural genomics, center for structural genomics of infec diseases, csgid, metal binding protein; NMR {Bacillus anthracis} Length = 71 Back     alignment and structure
>2l3m_A Copper-ION-binding protein; structural genomics, center for structural genomics of infec diseases, csgid, metal binding protein; NMR {Bacillus anthracis} Length = 71 Back     alignment and structure
>1fvq_A Copper-transporting ATPase; APO-CCC2A, hydrolase; NMR {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1fvs_A 2ggp_B Length = 72 Back     alignment and structure
>1fvq_A Copper-transporting ATPase; APO-CCC2A, hydrolase; NMR {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1fvs_A 2ggp_B Length = 72 Back     alignment and structure
>2kkh_A Putative heavy metal transporter; zinc transport, metal binding, metal selectivity, ferredoxin fold, ATP-binding, hydrolase; NMR {Arabidopsis thaliana} Length = 95 Back     alignment and structure
>2kkh_A Putative heavy metal transporter; zinc transport, metal binding, metal selectivity, ferredoxin fold, ATP-binding, hydrolase; NMR {Arabidopsis thaliana} Length = 95 Back     alignment and structure
>1cpz_A Protein (COPZ); copper chaperone, metal transport, gene regulation; NMR {Enterococcus hirae} SCOP: d.58.17.1 Length = 68 Back     alignment and structure
>1cpz_A Protein (COPZ); copper chaperone, metal transport, gene regulation; NMR {Enterococcus hirae} SCOP: d.58.17.1 Length = 68 Back     alignment and structure
>3dxs_X Copper-transporting ATPase RAN1; CXXC motif, ferredoxin-like fold, ATP- binding, ethylene signaling pathway, hydrolase, ION transport; 1.70A {Arabidopsis thaliana} Length = 74 Back     alignment and structure
>3dxs_X Copper-transporting ATPase RAN1; CXXC motif, ferredoxin-like fold, ATP- binding, ethylene signaling pathway, hydrolase, ION transport; 1.70A {Arabidopsis thaliana} Length = 74 Back     alignment and structure
>2k2p_A Uncharacterized protein ATU1203; putative metal-binding domain ATU1203, ontario centre for ST proteomics, structural genomics; NMR {Agrobacterium tumefaciens str} Length = 85 Back     alignment and structure
>1mwy_A ZNTA; open-faced beta-sandwich fold, beta-alpha-beta-BETA-alpha- beta, hydrolase; NMR {Escherichia coli} SCOP: d.58.17.1 PDB: 1mwz_A Length = 73 Back     alignment and structure
>1osd_A MERP, hypothetical protein MERP; mercury resistance, metal binding protein, perisplasm, structural genomics; 2.00A {Cupriavidus metallidurans} SCOP: d.58.17.1 PDB: 1afi_A 1afj_A 2hqi_A Length = 72 Back     alignment and structure
>1osd_A MERP, hypothetical protein MERP; mercury resistance, metal binding protein, perisplasm, structural genomics; 2.00A {Cupriavidus metallidurans} SCOP: d.58.17.1 PDB: 1afi_A 1afj_A 2hqi_A Length = 72 Back     alignment and structure
>2roe_A Heavy metal binding protein; NMR {Thermus thermophilus} PDB: 2rog_A Length = 66 Back     alignment and structure
>1opz_A Potential copper-transporting ATPase; mutation, folding, abbab fold, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 1oq3_A 1oq6_A Length = 76 Back     alignment and structure
>2ldi_A Zinc-transporting ATPase; metal homeostasis, metallochaperones, hydrolase; NMR {Synechocystis SP} Length = 71 Back     alignment and structure
>2ldi_A Zinc-transporting ATPase; metal homeostasis, metallochaperones, hydrolase; NMR {Synechocystis SP} Length = 71 Back     alignment and structure
>3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} Length = 723 Back     alignment and structure
>1y3j_A Copper-transporting ATPase 1; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta structure, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1y3k_A Length = 77 Back     alignment and structure
>1y3j_A Copper-transporting ATPase 1; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta structure, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1y3k_A Length = 77 Back     alignment and structure
>1yjr_A Copper-transporting ATPase 1; metallochaperone, protein-protein interaction, copper(I), metal homeostasis, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1yjt_A 1yju_A 1yjv_A Length = 75 Back     alignment and structure
>1yjr_A Copper-transporting ATPase 1; metallochaperone, protein-protein interaction, copper(I), metal homeostasis, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1yjt_A 1yju_A 1yjv_A Length = 75 Back     alignment and structure
>2kt2_A Mercuric reductase; nmera, MERA, HMA domain, mercuric resist metal-binding, oxidoreductase; NMR {Pseudomonas aeruginosa} PDB: 2kt3_A Length = 69 Back     alignment and structure
>1jww_A Potential copper-transporting ATPase; beta-alpha-beta-BETA-alpha-beta, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 2voy_A 1kqk_A Length = 80 Back     alignment and structure
>2aj0_A Probable cadmium-transporting ATPase; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta, metal binding protein, hydrolase; NMR {Listeria monocytogenes} PDB: 2aj1_A Length = 71 Back     alignment and structure
>2xmw_A PACS-N, cation-transporting ATPase PACS; hydrolase, Cu(I)-binding, trafficking; 1.80A {Synechocystis SP} PDB: 2gcf_A Length = 71 Back     alignment and structure
>2xmm_A SSR2857 protein, ATX1; metal transport, copper homeostasis, chaperone, P-type atpas; 1.65A {Synechocystis SP} PDB: 2xmv_A 1sb6_A 2xmj_A 2xmk_A 2xmt_A 2xmu_A Length = 64 Back     alignment and structure
>3fry_A Probable copper-exporting P-type ATPase A; transport protein, metal binding domain, domain SWAP, ATP-BI cell membrane, copper transport; HET: CIT; 2.00A {Archaeoglobus fulgidus} Length = 73 Back     alignment and structure
>2kyz_A Heavy metal binding protein; structural genomics, PSI-biology, protein structure initiative, joint for structural genomics, JCSG; NMR {Thermotoga maritima} Length = 67 Back     alignment and structure
>1jk9_B CCS, copper chaperone for superoxide dismutase; protein-protein complex, heterodimer, metallochaperone, amyotrophic lateral sclerosis; 2.90A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Length = 249 Back     alignment and structure
>2crl_A Copper chaperone for superoxide dismutase; SOD1, familial ALS, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 98 Back     alignment and structure
>1qup_A Superoxide dismutase 1 copper chaperone; two domains, beta-alpha-beta-BETA-alpha-beta and beta barrel; 1.80A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Length = 222 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query81
2ew9_A149 Copper-transporting ATPase 2; copper trafficking, 99.51
1p6t_A151 Potential copper-transporting ATPase; COPA, P-type 99.42
2rop_A202 Copper-transporting ATPase 2; wilson protein, mobi 99.32
4a4j_A69 Pacszia, cation-transporting ATPase PACS; hydrolas 98.97
3dxs_X74 Copper-transporting ATPase RAN1; CXXC motif, ferre 98.96
3iwl_A68 Copper transport protein ATOX1; beta-alpha-beta-BE 98.86
3fry_A73 Probable copper-exporting P-type ATPase A; transpo 98.85
1mwy_A73 ZNTA; open-faced beta-sandwich fold, beta-alpha-be 98.77
2g9o_A90 Copper-transporting ATPase 1; menkes disease, solu 98.77
2xmw_A71 PACS-N, cation-transporting ATPase PACS; hydrolase 98.74
2l3m_A71 Copper-ION-binding protein; structural genomics, c 98.72
3cjk_B75 Copper-transporting ATPase 1; HAH1, ATP7B, menkes 98.71
1osd_A72 MERP, hypothetical protein MERP; mercury resistanc 98.71
1yg0_A66 COP associated protein; open-faced beta-sandwich, 98.7
2roe_A66 Heavy metal binding protein; NMR {Thermus thermoph 98.69
2qif_A69 Copper chaperone COPZ; tetranuclear Cu(I) cluster; 98.68
2aj0_A71 Probable cadmium-transporting ATPase; ferrodoxin-l 98.68
2xmm_A64 SSR2857 protein, ATX1; metal transport, copper hom 98.67
1yjr_A75 Copper-transporting ATPase 1; metallochaperone, pr 98.67
1aw0_A72 Menkes copper-transporting ATPase; copper-binding 98.66
1cpz_A68 Protein (COPZ); copper chaperone, metal transport, 98.66
1fvq_A72 Copper-transporting ATPase; APO-CCC2A, hydrolase; 98.65
2kt2_A69 Mercuric reductase; nmera, MERA, HMA domain, mercu 98.63
2ldi_A71 Zinc-transporting ATPase; metal homeostasis, metal 98.63
1y3j_A77 Copper-transporting ATPase 1; ferrodoxin-like fold 98.62
1cc8_A73 Protein (metallochaperone ATX1); copper transport, 98.62
1q8l_A84 Copper-transporting ATPase 1; metal binding protei 98.61
2ofg_X111 Zinc-transporting ATPase; ferredoxin-like fold, be 98.6
1opz_A76 Potential copper-transporting ATPase; mutation, fo 98.6
2k2p_A85 Uncharacterized protein ATU1203; putative metal-bi 98.57
1kvi_A79 Copper-transporting ATPase 1; menkes, Cu-protein, 98.57
2kyz_A67 Heavy metal binding protein; structural genomics, 98.55
1jww_A80 Potential copper-transporting ATPase; beta-alpha-b 98.54
2kkh_A95 Putative heavy metal transporter; zinc transport, 98.46
2crl_A98 Copper chaperone for superoxide dismutase; SOD1, f 98.42
2rop_A 202 Copper-transporting ATPase 2; wilson protein, mobi 98.39
2ew9_A 149 Copper-transporting ATPase 2; copper trafficking, 98.37
1p6t_A 151 Potential copper-transporting ATPase; COPA, P-type 98.27
3j09_A 723 COPA, copper-exporting P-type ATPase A; copper tra 98.18
1qup_A 222 Superoxide dismutase 1 copper chaperone; two domai 98.13
2ofg_X111 Zinc-transporting ATPase; ferredoxin-like fold, be 98.0
1jk9_B 249 CCS, copper chaperone for superoxide dismutase; pr 97.98
3dxs_X74 Copper-transporting ATPase RAN1; CXXC motif, ferre 97.53
4a4j_A69 Pacszia, cation-transporting ATPase PACS; hydrolas 97.39
1cpz_A68 Protein (COPZ); copper chaperone, metal transport, 97.25
2l3m_A71 Copper-ION-binding protein; structural genomics, c 97.23
1aw0_A72 Menkes copper-transporting ATPase; copper-binding 97.17
1osd_A72 MERP, hypothetical protein MERP; mercury resistanc 97.11
2qif_A69 Copper chaperone COPZ; tetranuclear Cu(I) cluster; 97.1
3cjk_B75 Copper-transporting ATPase 1; HAH1, ATP7B, menkes 97.08
1kvi_A79 Copper-transporting ATPase 1; menkes, Cu-protein, 97.03
2kt2_A69 Mercuric reductase; nmera, MERA, HMA domain, mercu 96.98
1q8l_A84 Copper-transporting ATPase 1; metal binding protei 96.97
2ldi_A71 Zinc-transporting ATPase; metal homeostasis, metal 96.92
2g9o_A90 Copper-transporting ATPase 1; menkes disease, solu 96.84
1yg0_A66 COP associated protein; open-faced beta-sandwich, 96.76
1opz_A76 Potential copper-transporting ATPase; mutation, fo 96.73
2xmw_A71 PACS-N, cation-transporting ATPase PACS; hydrolase 96.71
1yjr_A75 Copper-transporting ATPase 1; metallochaperone, pr 96.44
1y3j_A77 Copper-transporting ATPase 1; ferrodoxin-like fold 96.43
3iwl_A68 Copper transport protein ATOX1; beta-alpha-beta-BE 96.24
3fry_A73 Probable copper-exporting P-type ATPase A; transpo 96.2
2kkh_A95 Putative heavy metal transporter; zinc transport, 96.17
1jww_A80 Potential copper-transporting ATPase; beta-alpha-b 96.1
1fvq_A72 Copper-transporting ATPase; APO-CCC2A, hydrolase; 95.98
1mwy_A73 ZNTA; open-faced beta-sandwich fold, beta-alpha-be 95.91
2kyz_A67 Heavy metal binding protein; structural genomics, 95.83
1cc8_A73 Protein (metallochaperone ATX1); copper transport, 95.73
2roe_A66 Heavy metal binding protein; NMR {Thermus thermoph 95.21
2k2p_A85 Uncharacterized protein ATU1203; putative metal-bi 95.16
2crl_A98 Copper chaperone for superoxide dismutase; SOD1, f 94.77
2xmm_A64 SSR2857 protein, ATX1; metal transport, copper hom 94.43
3j09_A 723 COPA, copper-exporting P-type ATPase A; copper tra 93.92
1qup_A 222 Superoxide dismutase 1 copper chaperone; two domai 86.67
1jk9_B 249 CCS, copper chaperone for superoxide dismutase; pr 84.91
>2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} Back     alignment and structure
Probab=99.51  E-value=2.7e-13  Score=73.62  Aligned_cols=78  Identities=27%  Similarity=0.533  Sum_probs=67.0

Q ss_pred             eEEEEecCCeEEEEEcCCCCCHHHHHHHHHhcCCcccCCC----CCceEEEEeccccchhHHHHHHHHhcCCCCeeEEEE
Q psy13020          4 RHQVSLEQKNANIRFNPIITNEETLRISIEDMGFDARLPS----TNDEATFTVDGMKCQSCVKKIEATIGEKPGVIAVKV   79 (81)
Q Consensus         4 ~~~v~~~~~~~~v~~~~~~~~~~~i~~~i~~~g~~~~~~~----~~~~~~~~i~g~~c~~C~~~i~~~l~~~~gv~~~~~   79 (81)
                      .+.+++.++++.+.+++.......+...+++.||.+....    ...+..|.+.||+|++|+..+++.|.+++||..+.+
T Consensus        34 ~~~v~~~~~~~~v~~~~~~~~~~~i~~~i~~~G~~~~~~~~~~~~~~~~~~~v~gm~C~~C~~~ie~~l~~~~gv~~~~v  113 (149)
T 2ew9_A           34 SVLVALMAGKAEIKYDPEVIQPLEIAQFIQDLGFEAAVMEDYAGSDGNIELTITGMTCASCVHNIESKLTRTNGITYASV  113 (149)
T ss_dssp             CEEEETTTTEEEEEECTTTCCHHHHHHHHHHHTCEEEECSCSCCSSSEEEEEEESCCSHHHHHHHHHHHHHSSSCCEEEE
T ss_pred             EEEEEecCCEEEEEEcCCCCCHHHHHHHHhcCCCceEeecccccccceeEEEEEeccCHHHHHHHHHHHhcCCCeEEEEE
Confidence            5678999999999998766778899999999999864322    225678999999999999999999999999999998


Q ss_pred             eC
Q psy13020         80 SH   81 (81)
Q Consensus        80 ~~   81 (81)
                      |+
T Consensus       114 ~~  115 (149)
T 2ew9_A          114 AL  115 (149)
T ss_dssp             ET
T ss_pred             Ec
Confidence            85
>1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} SCOP: d.58.17.1 d.58.17.1 PDB: 2rml_A Back     alignment and structure
>2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens} Back     alignment and structure
>4a4j_A Pacszia, cation-transporting ATPase PACS; hydrolase, copper homeostasis, zinc homeostasis, ATX1, metal-transporting atpases; 1.25A {Synechocystis} PDB: 4a48_A 2gcf_A 2xmw_A Back     alignment and structure
>3dxs_X Copper-transporting ATPase RAN1; CXXC motif, ferredoxin-like fold, ATP- binding, ethylene signaling pathway, hydrolase, ION transport; 1.70A {Arabidopsis thaliana} SCOP: d.58.17.0 Back     alignment and structure
>3iwl_A Copper transport protein ATOX1; beta-alpha-beta-BETA-alpha-beta, cisplatin, platinum, chaperone, ION transport, metal-binding, metal transport; HET: TCE; 1.60A {Homo sapiens} SCOP: d.58.17.1 PDB: 1fe4_A* 1fee_A* 1tl4_A 1tl5_A 2k1r_B 1fe0_A* 3iwx_A 3cjk_A Back     alignment and structure
>3fry_A Probable copper-exporting P-type ATPase A; transport protein, metal binding domain, domain SWAP, ATP-BI cell membrane, copper transport; HET: CIT; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>1mwy_A ZNTA; open-faced beta-sandwich fold, beta-alpha-beta-BETA-alpha- beta, hydrolase; NMR {Escherichia coli} SCOP: d.58.17.1 PDB: 1mwz_A Back     alignment and structure
>2g9o_A Copper-transporting ATPase 1; menkes disease, solution structure, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} PDB: 2ga7_A Back     alignment and structure
>2xmw_A PACS-N, cation-transporting ATPase PACS; hydrolase, Cu(I)-binding, trafficking; 1.80A {Synechocystis SP} PDB: 2gcf_A Back     alignment and structure
>2l3m_A Copper-ION-binding protein; structural genomics, center for structural genomics of infec diseases, csgid, metal binding protein; NMR {Bacillus anthracis} Back     alignment and structure
>3cjk_B Copper-transporting ATPase 1; HAH1, ATP7B, menkes disease, metal homeostasis, chaperone, ION transport, metal- binding, alternative splicing; 1.80A {Homo sapiens} PDB: 2k1r_A Back     alignment and structure
>1osd_A MERP, hypothetical protein MERP; mercury resistance, metal binding protein, perisplasm, structural genomics; 2.00A {Cupriavidus metallidurans} SCOP: d.58.17.1 PDB: 1afi_A 1afj_A 2hqi_A Back     alignment and structure
>1yg0_A COP associated protein; open-faced beta-sandwich, missing C-terminal beta-sheet, Met transport; NMR {Helicobacter pylori} Back     alignment and structure
>2roe_A Heavy metal binding protein; NMR {Thermus thermophilus} PDB: 2rog_A Back     alignment and structure
>2qif_A Copper chaperone COPZ; tetranuclear Cu(I) cluster; 1.50A {Bacillus subtilis} SCOP: d.58.17.1 PDB: 3i9z_A 1k0v_A 1p8g_A Back     alignment and structure
>2aj0_A Probable cadmium-transporting ATPase; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta, metal binding protein, hydrolase; NMR {Listeria monocytogenes} PDB: 2aj1_A Back     alignment and structure
>2xmm_A SSR2857 protein, ATX1; metal transport, copper homeostasis, chaperone, P-type atpas; 1.65A {Synechocystis SP} PDB: 2xmv_A 1sb6_A 2xmj_A 2xmk_A 2xmt_A 2xmu_A Back     alignment and structure
>1yjr_A Copper-transporting ATPase 1; metallochaperone, protein-protein interaction, copper(I), metal homeostasis, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1yjt_A 1yju_A 1yjv_A Back     alignment and structure
>1aw0_A Menkes copper-transporting ATPase; copper-binding domain, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 2aw0_A Back     alignment and structure
>1cpz_A Protein (COPZ); copper chaperone, metal transport, gene regulation; NMR {Enterococcus hirae} SCOP: d.58.17.1 Back     alignment and structure
>1fvq_A Copper-transporting ATPase; APO-CCC2A, hydrolase; NMR {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1fvs_A 2ggp_B Back     alignment and structure
>2kt2_A Mercuric reductase; nmera, MERA, HMA domain, mercuric resist metal-binding, oxidoreductase; NMR {Pseudomonas aeruginosa} PDB: 2kt3_A Back     alignment and structure
>2ldi_A Zinc-transporting ATPase; metal homeostasis, metallochaperones, hydrolase; NMR {Synechocystis SP} Back     alignment and structure
>1y3j_A Copper-transporting ATPase 1; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta structure, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1y3k_A Back     alignment and structure
>1cc8_A Protein (metallochaperone ATX1); copper transport, mercury coordination, metal transport; 1.02A {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1cc7_A 1fd8_A 1fes_A 2ggp_A 3k7r_A Back     alignment and structure
>1q8l_A Copper-transporting ATPase 1; metal binding protein; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1s6o_A 1s6u_A Back     alignment and structure
>1opz_A Potential copper-transporting ATPase; mutation, folding, abbab fold, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 1oq3_A 1oq6_A Back     alignment and structure
>2k2p_A Uncharacterized protein ATU1203; putative metal-binding domain ATU1203, ontario centre for ST proteomics, structural genomics; NMR {Agrobacterium tumefaciens str} Back     alignment and structure
>1kvi_A Copper-transporting ATPase 1; menkes, Cu-protein, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1kvj_A Back     alignment and structure
>2kyz_A Heavy metal binding protein; structural genomics, PSI-biology, protein structure initiative, joint for structural genomics, JCSG; NMR {Thermotoga maritima} Back     alignment and structure
>1jww_A Potential copper-transporting ATPase; beta-alpha-beta-BETA-alpha-beta, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 2voy_A 1kqk_A Back     alignment and structure
>2kkh_A Putative heavy metal transporter; zinc transport, metal binding, metal selectivity, ferredoxin fold, ATP-binding, hydrolase; NMR {Arabidopsis thaliana} Back     alignment and structure
>2crl_A Copper chaperone for superoxide dismutase; SOD1, familial ALS, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens} Back     alignment and structure
>2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} Back     alignment and structure
>1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} SCOP: d.58.17.1 d.58.17.1 PDB: 2rml_A Back     alignment and structure
>3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} Back     alignment and structure
>1qup_A Superoxide dismutase 1 copper chaperone; two domains, beta-alpha-beta-BETA-alpha-beta and beta barrel; 1.80A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Back     alignment and structure
>1jk9_B CCS, copper chaperone for superoxide dismutase; protein-protein complex, heterodimer, metallochaperone, amyotrophic lateral sclerosis; 2.90A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Back     alignment and structure
>3dxs_X Copper-transporting ATPase RAN1; CXXC motif, ferredoxin-like fold, ATP- binding, ethylene signaling pathway, hydrolase, ION transport; 1.70A {Arabidopsis thaliana} SCOP: d.58.17.0 Back     alignment and structure
>4a4j_A Pacszia, cation-transporting ATPase PACS; hydrolase, copper homeostasis, zinc homeostasis, ATX1, metal-transporting atpases; 1.25A {Synechocystis} PDB: 4a48_A 2gcf_A 2xmw_A Back     alignment and structure
>1cpz_A Protein (COPZ); copper chaperone, metal transport, gene regulation; NMR {Enterococcus hirae} SCOP: d.58.17.1 Back     alignment and structure
>2l3m_A Copper-ION-binding protein; structural genomics, center for structural genomics of infec diseases, csgid, metal binding protein; NMR {Bacillus anthracis} Back     alignment and structure
>1aw0_A Menkes copper-transporting ATPase; copper-binding domain, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 2aw0_A Back     alignment and structure
>1osd_A MERP, hypothetical protein MERP; mercury resistance, metal binding protein, perisplasm, structural genomics; 2.00A {Cupriavidus metallidurans} SCOP: d.58.17.1 PDB: 1afi_A 1afj_A 2hqi_A Back     alignment and structure
>2qif_A Copper chaperone COPZ; tetranuclear Cu(I) cluster; 1.50A {Bacillus subtilis} SCOP: d.58.17.1 PDB: 3i9z_A 1k0v_A 1p8g_A Back     alignment and structure
>3cjk_B Copper-transporting ATPase 1; HAH1, ATP7B, menkes disease, metal homeostasis, chaperone, ION transport, metal- binding, alternative splicing; 1.80A {Homo sapiens} PDB: 2k1r_A Back     alignment and structure
>1kvi_A Copper-transporting ATPase 1; menkes, Cu-protein, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1kvj_A Back     alignment and structure
>2kt2_A Mercuric reductase; nmera, MERA, HMA domain, mercuric resist metal-binding, oxidoreductase; NMR {Pseudomonas aeruginosa} PDB: 2kt3_A Back     alignment and structure
>1q8l_A Copper-transporting ATPase 1; metal binding protein; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1s6o_A 1s6u_A Back     alignment and structure
>2ldi_A Zinc-transporting ATPase; metal homeostasis, metallochaperones, hydrolase; NMR {Synechocystis SP} Back     alignment and structure
>2g9o_A Copper-transporting ATPase 1; menkes disease, solution structure, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} PDB: 2ga7_A Back     alignment and structure
>1yg0_A COP associated protein; open-faced beta-sandwich, missing C-terminal beta-sheet, Met transport; NMR {Helicobacter pylori} Back     alignment and structure
>1opz_A Potential copper-transporting ATPase; mutation, folding, abbab fold, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 1oq3_A 1oq6_A Back     alignment and structure
>2xmw_A PACS-N, cation-transporting ATPase PACS; hydrolase, Cu(I)-binding, trafficking; 1.80A {Synechocystis SP} PDB: 2gcf_A Back     alignment and structure
>1yjr_A Copper-transporting ATPase 1; metallochaperone, protein-protein interaction, copper(I), metal homeostasis, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1yjt_A 1yju_A 1yjv_A Back     alignment and structure
>1y3j_A Copper-transporting ATPase 1; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta structure, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1y3k_A Back     alignment and structure
>3iwl_A Copper transport protein ATOX1; beta-alpha-beta-BETA-alpha-beta, cisplatin, platinum, chaperone, ION transport, metal-binding, metal transport; HET: TCE; 1.60A {Homo sapiens} SCOP: d.58.17.1 PDB: 1fe4_A* 1fee_A* 1tl4_A 1tl5_A 2k1r_B 1fe0_A* 3iwx_A 3cjk_A Back     alignment and structure
>3fry_A Probable copper-exporting P-type ATPase A; transport protein, metal binding domain, domain SWAP, ATP-BI cell membrane, copper transport; HET: CIT; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>2kkh_A Putative heavy metal transporter; zinc transport, metal binding, metal selectivity, ferredoxin fold, ATP-binding, hydrolase; NMR {Arabidopsis thaliana} Back     alignment and structure
>1jww_A Potential copper-transporting ATPase; beta-alpha-beta-BETA-alpha-beta, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 2voy_A 1kqk_A Back     alignment and structure
>1fvq_A Copper-transporting ATPase; APO-CCC2A, hydrolase; NMR {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1fvs_A 2ggp_B Back     alignment and structure
>1mwy_A ZNTA; open-faced beta-sandwich fold, beta-alpha-beta-BETA-alpha- beta, hydrolase; NMR {Escherichia coli} SCOP: d.58.17.1 PDB: 1mwz_A Back     alignment and structure
>2kyz_A Heavy metal binding protein; structural genomics, PSI-biology, protein structure initiative, joint for structural genomics, JCSG; NMR {Thermotoga maritima} Back     alignment and structure
>1cc8_A Protein (metallochaperone ATX1); copper transport, mercury coordination, metal transport; 1.02A {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1cc7_A 1fd8_A 1fes_A 2ggp_A 3k7r_A Back     alignment and structure
>2roe_A Heavy metal binding protein; NMR {Thermus thermophilus} PDB: 2rog_A Back     alignment and structure
>2k2p_A Uncharacterized protein ATU1203; putative metal-binding domain ATU1203, ontario centre for ST proteomics, structural genomics; NMR {Agrobacterium tumefaciens str} Back     alignment and structure
>2crl_A Copper chaperone for superoxide dismutase; SOD1, familial ALS, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xmm_A SSR2857 protein, ATX1; metal transport, copper homeostasis, chaperone, P-type atpas; 1.65A {Synechocystis SP} PDB: 2xmv_A 1sb6_A 2xmj_A 2xmk_A 2xmt_A 2xmu_A Back     alignment and structure
>3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} Back     alignment and structure
>1qup_A Superoxide dismutase 1 copper chaperone; two domains, beta-alpha-beta-BETA-alpha-beta and beta barrel; 1.80A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Back     alignment and structure
>1jk9_B CCS, copper chaperone for superoxide dismutase; protein-protein complex, heterodimer, metallochaperone, amyotrophic lateral sclerosis; 2.90A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 81
d1p6ta172 d.58.17.1 (A:1-72) Potential copper-translocating 5e-08
d1osda_72 d.58.17.1 (A:) Mercuric ion binding protein MerP { 9e-08
d1osda_72 d.58.17.1 (A:) Mercuric ion binding protein MerP { 3e-04
d2qifa169 d.58.17.1 (A:1-69) Copper chaperone {Bacillus subt 1e-07
d2qifa169 d.58.17.1 (A:1-69) Copper chaperone {Bacillus subt 0.004
d2ggpb172 d.58.17.1 (B:1-72) Copper transporter domain ccc2a 2e-07
d1mwza_73 d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, 2e-07
d2aw0a_72 d.58.17.1 (A:) Menkes copper-transporting ATPase { 2e-07
d2aw0a_72 d.58.17.1 (A:) Menkes copper-transporting ATPase { 1e-04
d1p6ta279 d.58.17.1 (A:73-151) Potential copper-translocatin 3e-07
d1p6ta279 d.58.17.1 (A:73-151) Potential copper-translocatin 3e-04
d1kvja_79 d.58.17.1 (A:) Menkes copper-transporting ATPase { 3e-07
d1kvja_79 d.58.17.1 (A:) Menkes copper-transporting ATPase { 3e-05
d1cpza_68 d.58.17.1 (A:) Copper chaperone {Enterococcus hira 1e-06
d1cpza_68 d.58.17.1 (A:) Copper chaperone {Enterococcus hira 2e-04
d1q8la_84 d.58.17.1 (A:) Menkes copper-transporting ATPase { 2e-06
d1q8la_84 d.58.17.1 (A:) Menkes copper-transporting ATPase { 0.004
d1qupa272 d.58.17.1 (A:2-73) Copper chaperone for superoxide 6e-05
d1sb6a_64 d.58.17.1 (A:) Copper chaperone {Synechocystis sp. 7e-04
>d1p6ta1 d.58.17.1 (A:1-72) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Length = 72 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: HMA, heavy metal-associated domain
family: HMA, heavy metal-associated domain
domain: Potential copper-translocating P-type ATPase CopA (YvgX)
species: Bacillus subtilis [TaxId: 1423]

 Score = 43.2 bits (102), Expect = 5e-08
 Identities = 13/38 (34%), Positives = 17/38 (44%)

Query: 43 STNDEATFTVDGMKCQSCVKKIEATIGEKPGVIAVKVS 80
          S   E    V GM C +C  +IE  +   PGV    V+
Sbjct: 3  SEQKEIAMQVSGMTCAACAARIEKGLKRMPGVTDANVN 40
>d1osda_ d.58.17.1 (A:) Mercuric ion binding protein MerP {Ralstonia metallidurans CH34 [TaxId: 266264]} Length = 72 Back     information, alignment and structure
>d1osda_ d.58.17.1 (A:) Mercuric ion binding protein MerP {Ralstonia metallidurans CH34 [TaxId: 266264]} Length = 72 Back     information, alignment and structure
>d2qifa1 d.58.17.1 (A:1-69) Copper chaperone {Bacillus subtilis, CopZ [TaxId: 1423]} Length = 69 Back     information, alignment and structure
>d2qifa1 d.58.17.1 (A:1-69) Copper chaperone {Bacillus subtilis, CopZ [TaxId: 1423]} Length = 69 Back     information, alignment and structure
>d2ggpb1 d.58.17.1 (B:1-72) Copper transporter domain ccc2a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 72 Back     information, alignment and structure
>d1mwza_ d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 73 Back     information, alignment and structure
>d2aw0a_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Length = 72 Back     information, alignment and structure
>d2aw0a_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Length = 72 Back     information, alignment and structure
>d1p6ta2 d.58.17.1 (A:73-151) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Length = 79 Back     information, alignment and structure
>d1p6ta2 d.58.17.1 (A:73-151) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Length = 79 Back     information, alignment and structure
>d1kvja_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1kvja_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1cpza_ d.58.17.1 (A:) Copper chaperone {Enterococcus hirae [TaxId: 1354]} Length = 68 Back     information, alignment and structure
>d1cpza_ d.58.17.1 (A:) Copper chaperone {Enterococcus hirae [TaxId: 1354]} Length = 68 Back     information, alignment and structure
>d1q8la_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d1q8la_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d1qupa2 d.58.17.1 (A:2-73) Copper chaperone for superoxide dismutase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 72 Back     information, alignment and structure
>d1sb6a_ d.58.17.1 (A:) Copper chaperone {Synechocystis sp. pcc 6803, Scatx1 [TaxId: 1148]} Length = 64 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query81
d2ggpb172 Copper transporter domain ccc2a {Baker's yeast (Sa 99.19
d1p6ta172 Potential copper-translocating P-type ATPase CopA 99.17
d2qifa169 Copper chaperone {Bacillus subtilis, CopZ [TaxId: 99.17
d2aw0a_72 Menkes copper-transporting ATPase {Human (Homo sap 99.15
d1mwza_73 Metal ion-transporting ATPase ZntA, N-terminal dom 99.15
d1osda_72 Mercuric ion binding protein MerP {Ralstonia metal 99.14
d1cpza_68 Copper chaperone {Enterococcus hirae [TaxId: 1354] 99.13
d1q8la_84 Menkes copper-transporting ATPase {Human (Homo sap 99.07
d1p6ta279 Potential copper-translocating P-type ATPase CopA 99.06
d1kvja_79 Menkes copper-transporting ATPase {Human (Homo sap 99.05
d1sb6a_64 Copper chaperone {Synechocystis sp. pcc 6803, Scat 99.02
d1qupa272 Copper chaperone for superoxide dismutase, N-termi 98.89
d1cc8a_72 ATX1 metallochaperone protein (ATOX1) {Baker's yea 98.84
d1fe0a_66 ATX1 metallochaperone protein (ATOX1) {Human (Homo 98.74
d1cpza_68 Copper chaperone {Enterococcus hirae [TaxId: 1354] 98.36
d2aw0a_72 Menkes copper-transporting ATPase {Human (Homo sap 98.31
d1osda_72 Mercuric ion binding protein MerP {Ralstonia metal 98.12
d2qifa169 Copper chaperone {Bacillus subtilis, CopZ [TaxId: 98.12
d1p6ta172 Potential copper-translocating P-type ATPase CopA 98.07
d1q8la_84 Menkes copper-transporting ATPase {Human (Homo sap 98.06
d1kvja_79 Menkes copper-transporting ATPase {Human (Homo sap 98.05
d1p6ta279 Potential copper-translocating P-type ATPase CopA 98.04
d2ggpb172 Copper transporter domain ccc2a {Baker's yeast (Sa 97.81
d1mwza_73 Metal ion-transporting ATPase ZntA, N-terminal dom 97.17
d1fe0a_66 ATX1 metallochaperone protein (ATOX1) {Human (Homo 97.03
d1sb6a_64 Copper chaperone {Synechocystis sp. pcc 6803, Scat 96.94
d1qupa272 Copper chaperone for superoxide dismutase, N-termi 96.76
d1cc8a_72 ATX1 metallochaperone protein (ATOX1) {Baker's yea 96.62
>d2ggpb1 d.58.17.1 (B:1-72) Copper transporter domain ccc2a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: HMA, heavy metal-associated domain
family: HMA, heavy metal-associated domain
domain: Copper transporter domain ccc2a
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=99.19  E-value=8.4e-12  Score=59.90  Aligned_cols=36  Identities=28%  Similarity=0.583  Sum_probs=33.8

Q ss_pred             ceEEEEeccccchhHHHHHHHHhcCCCCeeEEEEeC
Q psy13020         46 DEATFTVDGMKCQSCVKKIEATIGEKPGVIAVKVSH   81 (81)
Q Consensus        46 ~~~~~~i~g~~c~~C~~~i~~~l~~~~gv~~~~~~~   81 (81)
                      ++..|.|.||+|++|+.+|++.|.+++||..+++||
T Consensus         2 k~v~l~V~GM~C~~C~~~Ie~~l~~~~gV~~v~V~~   37 (72)
T d2ggpb1           2 REVILAVHGMTCSACTNTINTQLRALKGVTKCDISL   37 (72)
T ss_dssp             EEEEEECTTCCSSTTTHHHHHHHTTSTTEEEEEECT
T ss_pred             eEEEEEECCcccHHHHHHHHHHHhcCCCceEEEEEC
Confidence            467899999999999999999999999999999986
>d1p6ta1 d.58.17.1 (A:1-72) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2qifa1 d.58.17.1 (A:1-69) Copper chaperone {Bacillus subtilis, CopZ [TaxId: 1423]} Back     information, alignment and structure
>d2aw0a_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mwza_ d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1osda_ d.58.17.1 (A:) Mercuric ion binding protein MerP {Ralstonia metallidurans CH34 [TaxId: 266264]} Back     information, alignment and structure
>d1cpza_ d.58.17.1 (A:) Copper chaperone {Enterococcus hirae [TaxId: 1354]} Back     information, alignment and structure
>d1q8la_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p6ta2 d.58.17.1 (A:73-151) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1kvja_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sb6a_ d.58.17.1 (A:) Copper chaperone {Synechocystis sp. pcc 6803, Scatx1 [TaxId: 1148]} Back     information, alignment and structure
>d1qupa2 d.58.17.1 (A:2-73) Copper chaperone for superoxide dismutase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1cc8a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fe0a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Human (Homo sapiens), HAH1 [TaxId: 9606]} Back     information, alignment and structure
>d1cpza_ d.58.17.1 (A:) Copper chaperone {Enterococcus hirae [TaxId: 1354]} Back     information, alignment and structure
>d2aw0a_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1osda_ d.58.17.1 (A:) Mercuric ion binding protein MerP {Ralstonia metallidurans CH34 [TaxId: 266264]} Back     information, alignment and structure
>d2qifa1 d.58.17.1 (A:1-69) Copper chaperone {Bacillus subtilis, CopZ [TaxId: 1423]} Back     information, alignment and structure
>d1p6ta1 d.58.17.1 (A:1-72) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1q8la_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kvja_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p6ta2 d.58.17.1 (A:73-151) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2ggpb1 d.58.17.1 (B:1-72) Copper transporter domain ccc2a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mwza_ d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fe0a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Human (Homo sapiens), HAH1 [TaxId: 9606]} Back     information, alignment and structure
>d1sb6a_ d.58.17.1 (A:) Copper chaperone {Synechocystis sp. pcc 6803, Scatx1 [TaxId: 1148]} Back     information, alignment and structure
>d1qupa2 d.58.17.1 (A:2-73) Copper chaperone for superoxide dismutase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1cc8a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure