Diaphorina citri psyllid: psy13022


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90---
MGYEVFLPLLDKSSSKSSMIGARTGVDSIKVSLADKEAVITYNPTLVSPKELSEAIYDMGFDTKVTQVDGKPYVPETNVNTSADGLAFKQGAD
cccEEEEECccccccHHHcccccccccEEEEEccccEEEEEEccccccHHHHHHHHHHccccEEECcccccccccccCEEEccccccHHcccc
*GYEVFLPLLDKSSSKSSMIGARTGVDSIKVSLADKEAVITYNPTLVSPKELSEAIYDMGFDTKVTQVDGKPY*************AF*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGYEVFLPLLDKSSSKSSMIGARTGVDSIKVSLADKEAVITYNPTLVSPKELSEAIYDMGFDTKVTQVDGKPYVPETNVNTSADGLAFKQGAD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0048471 [CC]perinuclear region of cytoplasmprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0015677 [BP]copper ion importprobableGO:0000041, GO:0006812, GO:0006811, GO:0035434, GO:0051179, GO:0008150, GO:0034220, GO:0044765, GO:0030001, GO:0006810, GO:0006825, GO:0044763, GO:0009987, GO:0051234, GO:0055085, GO:0044699
GO:0005507 [MF]copper ion bindingprobableGO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0006878 [BP]cellular copper ion homeostasisprobableGO:0019725, GO:0050801, GO:0009987, GO:0006873, GO:0048878, GO:0042592, GO:0055070, GO:0065007, GO:0044763, GO:0030003, GO:0055080, GO:0008150, GO:0055082, GO:0065008, GO:0044699
GO:0016323 [CC]basolateral plasma membraneprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0046688 [BP]response to copper ionprobableGO:0042221, GO:0050896, GO:0010035, GO:0008150, GO:0010038
GO:0016023 [CC]cytoplasmic membrane-bounded vesicleprobableGO:0005737, GO:0031982, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0043231
GO:0005923 [CC]tight junctionprobableGO:0005575, GO:0070160, GO:0043296, GO:0030054, GO:0005911
GO:0004008 [MF]copper-exporting ATPase activityprobableGO:0003674, GO:0016887, GO:0042625, GO:0042626, GO:0016820, GO:0046915, GO:0015399, GO:0046873, GO:0022804, GO:0016787, GO:0005215, GO:0008324, GO:0017111, GO:0043682, GO:0003824, GO:0005375, GO:0022891, GO:0022890, GO:0016818, GO:0022892, GO:0043492, GO:0042623, GO:0016817, GO:0019829, GO:0015075, GO:0016462, GO:0022857, GO:0015662, GO:0015405
GO:0005770 [CC]late endosomeprobableGO:0005737, GO:0043231, GO:0043227, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0005768, GO:0043226
GO:0051208 [BP]sequestering of calcium ionprobableGO:0050801, GO:0051238, GO:0042592, GO:0055074, GO:0051235, GO:0044699, GO:0072507, GO:0072503, GO:0065007, GO:0065008, GO:0019725, GO:0006875, GO:0006874, GO:0009987, GO:0006873, GO:0044763, GO:0030003, GO:0055065, GO:0055080, GO:0055082, GO:0051179, GO:0048878, GO:0008150
GO:0060003 [BP]copper ion exportprobableGO:0000041, GO:0006812, GO:0006811, GO:0035434, GO:0051179, GO:0008150, GO:0034220, GO:0044765, GO:0030001, GO:0006810, GO:0006825, GO:0044763, GO:0009987, GO:0051234, GO:0055085, GO:0044699
GO:0005524 [MF]ATP bindingprobableGO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0005802 [CC]trans-Golgi networkprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0008270 [MF]zinc ion bindingprobableGO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2ROP, chain A
Confidence level:very confident
Coverage over the Query: 7-66
View the alignment between query and template
View the model in PyMOL