Psyllid ID: psy13022

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90---
MGYEVFLPLLDKSSSKSSMIGARTGVDSIKVSLADKEAVITYNPTLVSPKELSEAIYDMGFDTKVTQVDGKPYVPETNVNTSADGLAFKQGAD
cccEEEEEEcccccHHHHcccccccccEEEEEccccEEEEEEccccccHHHHHHHHHHccccEEEEcccccccccccEEEEccccccHHcccc
ccEEEEEccccccccEEEEEcccccEEEEEEEEcccEEEEEEccccccHHHHHHHHHHcccEEEEcccccccccccccEEEcccHHHHHcccc
mgyevflplldkssskssmigartGVDSIKvsladkeavitynptlvspkeLSEAIYDMgfdtkvtqvdgkpyvpetnvntsadglafkqgad
MGYEVFLPlldkssskssmigarTGVDSIKVSLADKEAVitynptlvspkeLSEAIYDMGFDTKVTQVDGKPYVPetnvntsadglafkqgad
MGYEVFLPLLDkssskssMIGARTGVDSIKVSLADKEAVITYNPTLVSPKELSEAIYDMGFDTKVTQVDGKPYVPETNVNTSADGLAFKQGAD
************************GVDSIKVSLADKEAVITYNPTLVSPKELSEAIYDMGFDTKVTQVDGKPY********************
*GYEVFLPLLDKSSSKSSMIGARTGVDSIKVSLADKEAVITYNPTLVSPKELSEAIYDMGFDTKVT********************AF*****
MGYEVFLPLLDKSSSKSSMIGARTGVDSIKVSLADKEAVITYNPTLVSPKELSEAIYDMGFDTKVTQVDGKPYVPETNVNTSADGLAFKQGAD
*GYEVFLPLLDKSSSKSSMIGARTGVDSIKVSLADKEAVITYNPTLVSPKELSEAIYDMGFDTKVTQVDGKPYVPETNVNTSADGL*F*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGYEVFLPLLDKSSSKSSMIGARTGVDSIKVSLADKEAVITYNPTLVSPKELSEAIYDMGFDTKVTQVDGKPYVPETNVNTSADGLAFKQGAD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query93 2.2.26 [Sep-21-2011]
Q04656 1500 Copper-transporting ATPas yes N/A 0.612 0.038 0.5 9e-08
P70705 1492 Copper-transporting ATPas yes N/A 0.741 0.046 0.449 1e-07
P49015 1476 Copper-transporting ATPas yes N/A 0.623 0.039 0.465 2e-07
Q64430 1491 Copper-transporting ATPas yes N/A 0.623 0.038 0.482 3e-07
Q9XT50 1505 Copper-transporting ATPas N/A N/A 0.559 0.034 0.461 9e-07
P35670 1465 Copper-transporting ATPas no N/A 0.505 0.032 0.510 9e-07
Q64446 1462 Copper-transporting ATPas no N/A 0.365 0.023 0.536 2e-06
Q64535 1451 Copper-transporting ATPas no N/A 0.483 0.031 0.461 3e-06
>sp|Q04656|ATP7A_HUMAN Copper-transporting ATPase 1 OS=Homo sapiens GN=ATP7A PE=1 SV=3 Back     alignment and function desciption
 Score = 55.5 bits (132), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 35/58 (60%)

Query: 20 IGARTGVDSIKVSLADKEAVITYNPTLVSPKELSEAIYDMGFDTKVTQVDGKPYVPET 77
          IG   GV  IKVSL +K A I Y+P L +PK L EAI DMGFD  +   D  P + +T
Sbjct: 30 IGKVNGVHHIKVSLEEKNATIIYDPKLQTPKTLQEAIDDMGFDAVIHNPDPLPVLTDT 87
May supply copper to copper-requiring proteins within the secretory pathway, when localized in the trans-Golgi network. Under conditions of elevated extracellular copper, it relocalized to the plasma membrane where it functions in the efflux of copper from cells.
Homo sapiens (taxid: 9606)
EC: 3EC: .EC: 6EC: .EC: 3EC: .EC: 4
>sp|P70705|ATP7A_RAT Copper-transporting ATPase 1 OS=Rattus norvegicus GN=Atp7a PE=1 SV=1 Back     alignment and function description
>sp|P49015|ATP7A_CRIGR Copper-transporting ATPase 1 (Fragment) OS=Cricetulus griseus GN=ATP7A PE=2 SV=1 Back     alignment and function description
>sp|Q64430|ATP7A_MOUSE Copper-transporting ATPase 1 OS=Mus musculus GN=Atp7a PE=1 SV=3 Back     alignment and function description
>sp|Q9XT50|ATP7B_SHEEP Copper-transporting ATPase 2 OS=Ovis aries GN=ATP7B PE=2 SV=1 Back     alignment and function description
>sp|P35670|ATP7B_HUMAN Copper-transporting ATPase 2 OS=Homo sapiens GN=ATP7B PE=1 SV=4 Back     alignment and function description
>sp|Q64446|ATP7B_MOUSE Copper-transporting ATPase 2 OS=Mus musculus GN=Atp7b PE=1 SV=2 Back     alignment and function description
>sp|Q64535|ATP7B_RAT Copper-transporting ATPase 2 OS=Rattus norvegicus GN=Atp7b PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query93
432948502 847 PREDICTED: copper-transporting ATPase 1- 0.548 0.060 0.483 2e-07
432958424 502 PREDICTED: copper-transporting ATPase 1- 0.548 0.101 0.483 3e-07
432878721 1490 PREDICTED: copper-transporting ATPase 1- 0.548 0.034 0.483 3e-07
326924518 1494 PREDICTED: copper-transporting ATPase 1- 0.623 0.038 0.482 3e-07
326668465 1278 PREDICTED: copper-transporting ATPase 2 0.720 0.052 0.376 5e-07
21910928975 Chain B, Crystal Structure Of The Adduct 0.559 0.693 0.519 8e-07
355704941 1500 hypothetical protein EGK_20667 [Macaca m 0.741 0.046 0.463 2e-06
355757490 1500 hypothetical protein EGM_18930 [Macaca f 0.741 0.046 0.463 2e-06
390357245 1361 PREDICTED: copper-transporting ATPase 2- 0.268 0.018 0.581 2e-06
297304204 1378 PREDICTED: copper-transporting ATPase 1- 0.741 0.050 0.463 2e-06
>gi|432948502|ref|XP_004084077.1| PREDICTED: copper-transporting ATPase 1-like, partial [Oryzias latipes] Back     alignment and taxonomy information
 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 37/60 (61%), Gaps = 9/60 (15%)

Query: 19  MIGARTGVDSIKVSLADKEAVITYNPTLVSPKELSEAIYDMGFDTKVTQVDGKPYVPETN 78
           MI  R GV S +VSLAD + +  Y+P L SP+EL EA+ DMGFD          ++PETN
Sbjct: 375 MISQRKGVVSAQVSLADHQGIFEYDPLLTSPQELREAVEDMGFDA---------FLPETN 425

Source: Oryzias latipes

Species: Oryzias latipes

Genus: Oryzias

Family: Adrianichthyidae

Order: Beloniformes

Class: Actinopterygii

Phylum: Chordata

Superkingdom: Eukaryota
>gi|432958424|ref|XP_004086025.1| PREDICTED: copper-transporting ATPase 1-like, partial [Oryzias latipes] Back     alignment and taxonomy information
>gi|432878721|ref|XP_004073381.1| PREDICTED: copper-transporting ATPase 1-like [Oryzias latipes] Back     alignment and taxonomy information
>gi|326924518|ref|XP_003208474.1| PREDICTED: copper-transporting ATPase 1-like [Meleagris gallopavo] Back     alignment and taxonomy information
>gi|326668465|ref|XP_684415.4| PREDICTED: copper-transporting ATPase 2 [Danio rerio] Back     alignment and taxonomy information
>gi|219109289|pdb|3CJK|B Chain B, Crystal Structure Of The Adduct Hah1-Cd(Ii)-Mnk1 Back     alignment and taxonomy information
>gi|355704941|gb|EHH30866.1| hypothetical protein EGK_20667 [Macaca mulatta] Back     alignment and taxonomy information
>gi|355757490|gb|EHH61015.1| hypothetical protein EGM_18930 [Macaca fascicularis] Back     alignment and taxonomy information
>gi|390357245|ref|XP_797382.3| PREDICTED: copper-transporting ATPase 2-like [Strongylocentrotus purpuratus] Back     alignment and taxonomy information
>gi|297304204|ref|XP_002806338.1| PREDICTED: copper-transporting ATPase 1-like [Macaca mulatta] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query93
UNIPROTKB|F1NUA1 1476 F1NUA1 "Uncharacterized protei 0.623 0.039 0.465 8.7e-08
UNIPROTKB|F1NJ24 1497 F1NJ24 "Uncharacterized protei 0.623 0.038 0.465 8.8e-08
UNIPROTKB|Q04656 1500 ATP7A "Copper-transporting ATP 0.623 0.038 0.5 3.8e-07
UNIPROTKB|F1LM77 1490 Atp7a "Copper-transporting ATP 0.623 0.038 0.482 7.9e-07
UNIPROTKB|F1LQK4 1491 Atp7a "Copper-transporting ATP 0.623 0.038 0.482 8e-07
RGD|2179 1492 Atp7a "ATPase, Cu++ transporti 0.623 0.038 0.482 8e-07
UNIPROTKB|F1PK99 1499 ATP7A "Uncharacterized protein 0.731 0.045 0.470 1e-06
UNIPROTKB|K7GT44 1500 ATP7A "ATPase, Cu++ transporti 0.731 0.045 0.470 1e-06
UNIPROTKB|F1RPH3 1502 ATP7A "Uncharacterized protein 0.731 0.045 0.470 1e-06
UNIPROTKB|F5H562 1035 ATP7B "WND/140 kDa" [Homo sapi 0.580 0.052 0.462 1.4e-06
UNIPROTKB|F1NUA1 F1NUA1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 137 (53.3 bits), Expect = 8.7e-08, P = 8.7e-08
 Identities = 27/58 (46%), Positives = 37/58 (63%)

Query:    20 IGARTGVDSIKVSLADKEAVITYNPTLVSPKELSEAIYDMGFDTKVTQVDGKPYVPET 77
             +G   G+ ++KVSL DK AVI Y+  L +P  L EAIYDMGFD      + +P +P+T
Sbjct:    29 VGKMNGIHNVKVSLEDKNAVIIYDSKLHTPATLQEAIYDMGFDATSAGSNPQPVLPDT 86
GO:0005507 "copper ion binding" evidence=IEA
GO:0006825 "copper ion transport" evidence=IEA
GO:0019829 "cation-transporting ATPase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0016021 "integral to membrane" evidence=IEA
UNIPROTKB|F1NJ24 F1NJ24 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q04656 ATP7A "Copper-transporting ATPase 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1LM77 Atp7a "Copper-transporting ATPase 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1LQK4 Atp7a "Copper-transporting ATPase 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
RGD|2179 Atp7a "ATPase, Cu++ transporting, alpha polypeptide" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1PK99 ATP7A "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|K7GT44 ATP7A "ATPase, Cu++ transporting, alpha polypeptide" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1RPH3 ATP7A "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F5H562 ATP7B "WND/140 kDa" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query93
cd0037163 cd00371, HMA, Heavy-metal-associated domain (HMA) 1e-07
pfam0040362 pfam00403, HMA, Heavy-metal-associated domain 0.001
COG260871 COG2608, CopZ, Copper chaperone [Inorganic ion tra 0.004
>gnl|CDD|238219 cd00371, HMA, Heavy-metal-associated domain (HMA) is a conserved domain of approximately 30 amino acid residues found in a number of proteins that transport or detoxify heavy metals, for example, the CPx-type heavy metal ATPases and copper chaperones Back     alignment and domain information 
 Score = 44.1 bits (105), Expect = 1e-07
 Identities = 18/43 (41%), Positives = 27/43 (62%), Gaps = 1/43 (2%)

Query: 20 IGARTGVDSIKVSLADKEAVITYNPTLVSPKELSEAIYDMGFD 62
          +    GV+S++V L   +A + Y+P  VSP+EL EAI D G+ 
Sbjct: 20 LEKLPGVESVEVDLETGKATVEYDPE-VSPEELLEAIEDAGYK 61

HMA domain contains two cysteine residues that are important in binding and transfer of metal ions, such as copper, cadmium, cobalt and zinc. In the case of copper, stoichiometry of binding is one Cu+ ion per binding domain. Repeats of the HMA domain in copper chaperone has been associated with Menkes/Wilson disease due to binding of multiple copper ions. Length = 63
>gnl|CDD|215902 pfam00403, HMA, Heavy-metal-associated domain Back     alignment and domain information
>gnl|CDD|225328 COG2608, CopZ, Copper chaperone [Inorganic ion transport and metabolism] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 93
PF0040362 HMA: Heavy-metal-associated domain; InterPro: IPR0 99.62
COG260871 CopZ Copper chaperone [Inorganic ion transport and 99.49
KOG4656|consensus 247 99.02
PLN02957 238 copper, zinc superoxide dismutase 98.58
KOG1603|consensus73 98.54
COG2217 713 ZntA Cation transport ATPase [Inorganic ion transp 98.53
KOG0207|consensus 951 98.43
KOG0207|consensus 951 98.27
TIGR0000368 copper ion binding protein. This model describes a 98.23
PRK10671 834 copA copper exporting ATPase; Provisional 98.1
PRK11033 741 zntA zinc/cadmium/mercury/lead-transporting ATPase 97.49
PRK10671 834 copA copper exporting ATPase; Provisional 97.0
PRK14054172 methionine sulfoxide reductase A; Provisional 96.57
TIGR0205292 MerP mercuric transport protein periplasmic compon 95.95
PRK05528156 methionine sulfoxide reductase A; Provisional 95.76
PRK00058213 methionine sulfoxide reductase A; Provisional 95.48
PRK13014186 methionine sulfoxide reductase A; Provisional 95.4
PF01625155 PMSR: Peptide methionine sulfoxide reductase; Inte 95.08
TIGR00401149 msrA methionine-S-sulfoxide reductase. This model 94.09
COG0225174 MsrA Peptide methionine sulfoxide reductase [Postt 93.99
PRK13748 561 putative mercuric reductase; Provisional 93.92
PRK05550283 bifunctional methionine sulfoxide reductase B/A pr 93.89
COG188897 Uncharacterized protein conserved in archaea [Func 93.31
PF0120670 TusA: Sulfurtransferase TusA; InterPro: IPR001455 93.29
PF0268095 DUF211: Uncharacterized ArCR, COG1888; InterPro: I 92.14
cd0037163 HMA Heavy-metal-associated domain (HMA) is a conse 90.88
PRK1101878 hypothetical protein; Provisional 90.0
PRK14018 521 trifunctional thioredoxin/methionine sulfoxide red 89.98
PF1149188 DUF3213: Protein of unknown function (DUF3213) ; I 88.81
cd0342269 YedF YedF is a bacterial SirA-like protein of unkn 87.21
PF09580177 Spore_YhcN_YlaJ: Sporulation lipoprotein YhcN/YlaJ 86.97
cd0342369 SirA SirA (also known as UvrY, and YhhP) belongs t 86.74
cd0029169 SirA_YedF_YeeD SirA, YedF, and YeeD. Two-layered a 86.63
cd0342069 SirA_RHOD_Pry_redox SirA_RHOD_Pry_redox. SirA-like 85.86
PF0188372 DUF59: Domain of unknown function DUF59; InterPro: 85.83
KOG1635|consensus191 82.81
cd0342167 SirA_like_N SirA_like_N, a protein of unknown func 82.38
PF0480570 Pox_E10: E10-like protein conserved region; InterP 82.21
>PF00403 HMA: Heavy-metal-associated domain; InterPro: IPR006121 Proteins that transport heavy metals in micro-organisms and mammals share similarities in their sequences and structures Back     alignment and domain information 
Probab=99.62  E-value=4.7e-15  Score=83.94  Aligned_cols=60  Identities=27%  Similarity=0.423  Sum_probs=57.0

Q ss_pred             cee-cCCChhhHHHHHHhhhcCCCceEEEEecCCcEEEEEECCCCCCHHHHHHHHHhCCCc
Q psy13022          3 YEV-FLPLLDKSSSKSSMIGARTGVDSIKVSLADKEAVITYNPTLVSPKELSEAIYDMGFD   62 (93)
Q Consensus         3 ~~v-~m~c~~C~~~Iek~L~~l~GV~~v~v~l~~~~v~V~~d~~~~~~~~I~~~I~~~Gy~   62 (93)
                      |.| .|.|.+|+.+|+++|.+++||.++.+|+.++++.|.|++...++++|.++|+++||+
T Consensus         2 ~~v~~m~C~~C~~~v~~~l~~~~GV~~v~vd~~~~~v~v~~~~~~~~~~~i~~~i~~~Gy~   62 (62)
T PF00403_consen    2 FKVPGMTCEGCAKKVEKALSKLPGVKSVKVDLETKTVTVTYDPDKTSIEKIIEAIEKAGYE   62 (62)
T ss_dssp             EEEESTTSHHHHHHHHHHHHTSTTEEEEEEETTTTEEEEEESTTTSCHHHHHHHHHHTTSE
T ss_pred             EEECCcccHHHHHHHHHHHhcCCCCcEEEEECCCCEEEEEEecCCCCHHHHHHHHHHhCcC
Confidence            567 799999999999999999999999999999999999998878899999999999995

These proteins provide an important focus for research, some being involved in bacterial resistance to toxic metals, such as lead and cadmium, while others are involved in inherited human syndromes, such as Wilson's and Menke's diseases []. A conserved domain has been found in a number of these heavy metal transport or detoxification proteins []. The domain, which has been termed Heavy-Metal-Associated (HMA), contains two conserved cysteines that are probably involved in metal binding. Structure solution of the fourth HMA domain of the Menke's copper transporting ATPase shows a well-defined structure comprising a four-stranded antiparallel beta-sheet and two alpha helices packed in an alpha-beta sandwich fold []. This fold is common to other domains and is classified as "ferredoxin-like".; GO: 0046872 metal ion binding, 0030001 metal ion transport; PDB: 2VOY_A 1P6T_A 1KQK_A 2RML_A 1JWW_A 3K7R_F 1FES_A 1CC8_A 1FD8_A 2GGP_A ....
>COG2608 CopZ Copper chaperone [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG4656|consensus Back     alignment and domain information
>PLN02957 copper, zinc superoxide dismutase Back     alignment and domain information
>KOG1603|consensus Back     alignment and domain information
>COG2217 ZntA Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0207|consensus Back     alignment and domain information
>KOG0207|consensus Back     alignment and domain information
>TIGR00003 copper ion binding protein Back     alignment and domain information
>PRK10671 copA copper exporting ATPase; Provisional Back     alignment and domain information
>PRK11033 zntA zinc/cadmium/mercury/lead-transporting ATPase; Provisional Back     alignment and domain information
>PRK10671 copA copper exporting ATPase; Provisional Back     alignment and domain information
>PRK14054 methionine sulfoxide reductase A; Provisional Back     alignment and domain information
>TIGR02052 MerP mercuric transport protein periplasmic component Back     alignment and domain information
>PRK05528 methionine sulfoxide reductase A; Provisional Back     alignment and domain information
>PRK00058 methionine sulfoxide reductase A; Provisional Back     alignment and domain information
>PRK13014 methionine sulfoxide reductase A; Provisional Back     alignment and domain information
>PF01625 PMSR: Peptide methionine sulfoxide reductase; InterPro: IPR002569 Peptide methionine sulphoxide reductase (Msr) reverses the inactivation of many proteins due to the oxidation of critical methionine residues by reducing methionine sulphoxide, Met(O), to methionine [] Back     alignment and domain information
>TIGR00401 msrA methionine-S-sulfoxide reductase Back     alignment and domain information
>COG0225 MsrA Peptide methionine sulfoxide reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK05550 bifunctional methionine sulfoxide reductase B/A protein; Provisional Back     alignment and domain information
>COG1888 Uncharacterized protein conserved in archaea [Function unknown] Back     alignment and domain information
>PF01206 TusA: Sulfurtransferase TusA; InterPro: IPR001455 SirA functions as a response regulator as part of a two-component system, where BarA is the sensor kinase Back     alignment and domain information
>PF02680 DUF211: Uncharacterized ArCR, COG1888; InterPro: IPR003831 This entry describes proteins of unknown function Back     alignment and domain information
>cd00371 HMA Heavy-metal-associated domain (HMA) is a conserved domain of approximately 30 amino acid residues found in a number of proteins that transport or detoxify heavy metals, for example, the CPx-type heavy metal ATPases and copper chaperones Back     alignment and domain information
>PRK11018 hypothetical protein; Provisional Back     alignment and domain information
>PRK14018 trifunctional thioredoxin/methionine sulfoxide reductase A/B protein; Provisional Back     alignment and domain information
>PF11491 DUF3213: Protein of unknown function (DUF3213) ; InterPro: IPR021583 The backbone structure of this family of proteins has been determined however the function remains unknown Back     alignment and domain information
>cd03422 YedF YedF is a bacterial SirA-like protein of unknown function Back     alignment and domain information
>PF09580 Spore_YhcN_YlaJ: Sporulation lipoprotein YhcN/YlaJ (Spore_YhcN_YlaJ); InterPro: IPR019076 This entry contains YhcN and YlaJ, which are predicted lipoproteins that have been detected as spore proteins but not vegetative proteins in Bacillus subtilis Back     alignment and domain information
>cd03423 SirA SirA (also known as UvrY, and YhhP) belongs to a family of two-component response regulators that controls secondary metabolism and virulence Back     alignment and domain information
>cd00291 SirA_YedF_YeeD SirA, YedF, and YeeD Back     alignment and domain information
>cd03420 SirA_RHOD_Pry_redox SirA_RHOD_Pry_redox Back     alignment and domain information
>PF01883 DUF59: Domain of unknown function DUF59; InterPro: IPR002744 This family includes prokaryotic proteins of unknown function Back     alignment and domain information
>KOG1635|consensus Back     alignment and domain information
>cd03421 SirA_like_N SirA_like_N, a protein of unknown function with an N-terminal SirA-like domain Back     alignment and domain information
>PF04805 Pox_E10: E10-like protein conserved region; InterPro: IPR006890 This entry represents a family of probable FAD-linked sulphydryl oxidases found in poxviruses Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query93
3cjk_B75 Crystal Structure Of The Adduct Hah1-Cd(Ii)-Mnk1 Le 2e-09
2k1r_A73 The Solution Nmr Structure Of The Complex Between M 4e-08
1kvi_A79 Solution Structure Of The Reduced Form Of The First 4e-08
2rop_A202 Solution Structure Of Domains 3 And 4 Of Human Atp7 7e-08
1s6o_A76 Solution Structure And Backbone Dynamics Of The Apo 8e-07
1aw0_A72 Fourth Metal-Binding Domain Of The Menkes Copper- T 2e-06
1q8l_A84 Second Metal Binding Domain Of The Menkes Atpase Le 1e-05
>pdb|3CJK|B Chain B, Crystal Structure Of The Adduct Hah1-Cd(Ii)-Mnk1 Length = 75 Back     alignment and structure 
Iteration: 1

 Score = 57.4 bits (137), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 27/52 (51%), Positives = 34/52 (65%)
Query: 20 IGARTGVDSIKVSLADKEAVITYNPTLVSPKELSEAIYDMGFDTKVTQVDGK 71
          IG   GV  IKVSL +K A I Y+P L +PK L EAI DMGFD  +  ++G+
Sbjct: 24 IGKVNGVHHIKVSLEEKNATIIYDPKLQTPKTLQEAIDDMGFDAVIHNIEGR 75
>pdb|2K1R|A Chain A, The Solution Nmr Structure Of The Complex Between Mnk1 And Hah1 Mediated By Cu(I) Length = 73 Back     alignment and structure
>pdb|1KVI|A Chain A, Solution Structure Of The Reduced Form Of The First Heavy Metal Binding Motif Of The Menkes Protein Length = 79 Back     alignment and structure
>pdb|2ROP|A Chain A, Solution Structure Of Domains 3 And 4 Of Human Atp7b Length = 202 Back     alignment and structure
>pdb|1S6O|A Chain A, Solution Structure And Backbone Dynamics Of The Apo-Form Of The Second Metal-Binding Domain Of The Menkes Protein Atp7a Length = 76 Back     alignment and structure
>pdb|1AW0|A Chain A, Fourth Metal-Binding Domain Of The Menkes Copper- Transporting Atpase, Nmr, 20 Structures Length = 72 Back     alignment and structure
>pdb|1Q8L|A Chain A, Second Metal Binding Domain Of The Menkes Atpase Length = 84 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query93
3cjk_B75 Copper-transporting ATPase 1; HAH1, ATP7B, menkes 1e-14
1kvi_A79 Copper-transporting ATPase 1; menkes, Cu-protein, 4e-13
1aw0_A72 Menkes copper-transporting ATPase; copper-binding 5e-12
2g9o_A90 Copper-transporting ATPase 1; menkes disease, solu 3e-11
1q8l_A84 Copper-transporting ATPase 1; metal binding protei 3e-11
2rop_A202 Copper-transporting ATPase 2; wilson protein, mobi 7e-11
2rop_A202 Copper-transporting ATPase 2; wilson protein, mobi 4e-07
2l3m_A71 Copper-ION-binding protein; structural genomics, c 1e-10
1osd_A72 MERP, hypothetical protein MERP; mercury resistanc 2e-10
1y3j_A77 Copper-transporting ATPase 1; ferrodoxin-like fold 3e-10
2qif_A69 Copper chaperone COPZ; tetranuclear Cu(I) cluster; 3e-10
2ew9_A149 Copper-transporting ATPase 2; copper trafficking, 4e-10
2ew9_A149 Copper-transporting ATPase 2; copper trafficking, 9e-10
3dxs_X74 Copper-transporting ATPase RAN1; CXXC motif, ferre 5e-10
1cpz_A68 Protein (COPZ); copper chaperone, metal transport, 2e-09
1yjr_A75 Copper-transporting ATPase 1; metallochaperone, pr 2e-09
2kkh_A95 Putative heavy metal transporter; zinc transport, 4e-09
1p6t_A151 Potential copper-transporting ATPase; COPA, P-type 4e-09
1p6t_A151 Potential copper-transporting ATPase; COPA, P-type 8e-09
1fvq_A72 Copper-transporting ATPase; APO-CCC2A, hydrolase; 5e-09
2ldi_A71 Zinc-transporting ATPase; metal homeostasis, metal 8e-08
2ofg_X111 Zinc-transporting ATPase; ferredoxin-like fold, be 6e-07
1opz_A76 Potential copper-transporting ATPase; mutation, fo 1e-06
1jww_A80 Potential copper-transporting ATPase; beta-alpha-b 2e-06
1yg0_A66 COP associated protein; open-faced beta-sandwich, 5e-06
2xmw_A71 PACS-N, cation-transporting ATPase PACS; hydrolase 4e-05
3j09_A 723 COPA, copper-exporting P-type ATPase A; copper tra 4e-05
2kt2_A69 Mercuric reductase; nmera, MERA, HMA domain, mercu 8e-05
2roe_A66 Heavy metal binding protein; NMR {Thermus thermoph 6e-04
>3cjk_B Copper-transporting ATPase 1; HAH1, ATP7B, menkes disease, metal homeostasis, chaperone, ION transport, metal- binding, alternative splicing; 1.80A {Homo sapiens} PDB: 2k1r_A Length = 75 Back     alignment and structure
 Score = 61.9 bits (151), Expect = 1e-14
 Identities = 27/54 (50%), Positives = 34/54 (62%)

Query: 18 SMIGARTGVDSIKVSLADKEAVITYNPTLVSPKELSEAIYDMGFDTKVTQVDGK 71
            IG   GV  IKVSL +K A I Y+P L +PK L EAI DMGFD  +  ++G+
Sbjct: 22 QQIGKVNGVHHIKVSLEEKNATIIYDPKLQTPKTLQEAIDDMGFDAVIHNIEGR 75
>1kvi_A Copper-transporting ATPase 1; menkes, Cu-protein, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1kvj_A Length = 79 Back     alignment and structure
>1aw0_A Menkes copper-transporting ATPase; copper-binding domain, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 2aw0_A Length = 72 Back     alignment and structure
>2g9o_A Copper-transporting ATPase 1; menkes disease, solution structure, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} PDB: 2ga7_A Length = 90 Back     alignment and structure
>1q8l_A Copper-transporting ATPase 1; metal binding protein; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1s6o_A 1s6u_A Length = 84 Back     alignment and structure
>2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens} Length = 202 Back     alignment and structure
>2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens} Length = 202 Back     alignment and structure
>2l3m_A Copper-ION-binding protein; structural genomics, center for structural genomics of infec diseases, csgid, metal binding protein; NMR {Bacillus anthracis} Length = 71 Back     alignment and structure
>1osd_A MERP, hypothetical protein MERP; mercury resistance, metal binding protein, perisplasm, structural genomics; 2.00A {Cupriavidus metallidurans} SCOP: d.58.17.1 PDB: 1afi_A 1afj_A 2hqi_A Length = 72 Back     alignment and structure
>1y3j_A Copper-transporting ATPase 1; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta structure, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1y3k_A Length = 77 Back     alignment and structure
>2qif_A Copper chaperone COPZ; tetranuclear Cu(I) cluster; 1.50A {Bacillus subtilis} SCOP: d.58.17.1 PDB: 3i9z_A 1k0v_A 1p8g_A Length = 69 Back     alignment and structure
>2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} Length = 149 Back     alignment and structure
>2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} Length = 149 Back     alignment and structure
>3dxs_X Copper-transporting ATPase RAN1; CXXC motif, ferredoxin-like fold, ATP- binding, ethylene signaling pathway, hydrolase, ION transport; 1.70A {Arabidopsis thaliana} Length = 74 Back     alignment and structure
>1cpz_A Protein (COPZ); copper chaperone, metal transport, gene regulation; NMR {Enterococcus hirae} SCOP: d.58.17.1 Length = 68 Back     alignment and structure
>1yjr_A Copper-transporting ATPase 1; metallochaperone, protein-protein interaction, copper(I), metal homeostasis, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1yjt_A 1yju_A 1yjv_A Length = 75 Back     alignment and structure
>2kkh_A Putative heavy metal transporter; zinc transport, metal binding, metal selectivity, ferredoxin fold, ATP-binding, hydrolase; NMR {Arabidopsis thaliana} Length = 95 Back     alignment and structure
>1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} SCOP: d.58.17.1 d.58.17.1 PDB: 2rml_A Length = 151 Back     alignment and structure
>1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} SCOP: d.58.17.1 d.58.17.1 PDB: 2rml_A Length = 151 Back     alignment and structure
>1fvq_A Copper-transporting ATPase; APO-CCC2A, hydrolase; NMR {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1fvs_A 2ggp_B Length = 72 Back     alignment and structure
>2ldi_A Zinc-transporting ATPase; metal homeostasis, metallochaperones, hydrolase; NMR {Synechocystis SP} Length = 71 Back     alignment and structure
>1opz_A Potential copper-transporting ATPase; mutation, folding, abbab fold, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 1oq3_A 1oq6_A Length = 76 Back     alignment and structure
>1jww_A Potential copper-transporting ATPase; beta-alpha-beta-BETA-alpha-beta, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 2voy_A 1kqk_A Length = 80 Back     alignment and structure
>1yg0_A COP associated protein; open-faced beta-sandwich, missing C-terminal beta-sheet, Met transport; NMR {Helicobacter pylori} Length = 66 Back     alignment and structure
>2xmw_A PACS-N, cation-transporting ATPase PACS; hydrolase, Cu(I)-binding, trafficking; 1.80A {Synechocystis SP} PDB: 2gcf_A Length = 71 Back     alignment and structure
>3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} Length = 723 Back     alignment and structure
>2kt2_A Mercuric reductase; nmera, MERA, HMA domain, mercuric resist metal-binding, oxidoreductase; NMR {Pseudomonas aeruginosa} PDB: 2kt3_A Length = 69 Back     alignment and structure
>2roe_A Heavy metal binding protein; NMR {Thermus thermophilus} PDB: 2rog_A Length = 66 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query93
4a4j_A69 Pacszia, cation-transporting ATPase PACS; hydrolas 99.54
3dxs_X74 Copper-transporting ATPase RAN1; CXXC motif, ferre 99.54
3iwl_A68 Copper transport protein ATOX1; beta-alpha-beta-BE 99.52
1cc8_A73 Protein (metallochaperone ATX1); copper transport, 99.47
1osd_A72 MERP, hypothetical protein MERP; mercury resistanc 99.45
3cjk_B75 Copper-transporting ATPase 1; HAH1, ATP7B, menkes 99.43
2xmw_A71 PACS-N, cation-transporting ATPase PACS; hydrolase 99.42
2crl_A98 Copper chaperone for superoxide dismutase; SOD1, f 99.42
2l3m_A71 Copper-ION-binding protein; structural genomics, c 99.42
1cpz_A68 Protein (COPZ); copper chaperone, metal transport, 99.41
2qif_A69 Copper chaperone COPZ; tetranuclear Cu(I) cluster; 99.41
3fry_A73 Probable copper-exporting P-type ATPase A; transpo 99.41
2g9o_A90 Copper-transporting ATPase 1; menkes disease, solu 99.39
1kvi_A79 Copper-transporting ATPase 1; menkes, Cu-protein, 99.39
2kt2_A69 Mercuric reductase; nmera, MERA, HMA domain, mercu 99.39
1yg0_A66 COP associated protein; open-faced beta-sandwich, 99.38
1aw0_A72 Menkes copper-transporting ATPase; copper-binding 99.37
2ldi_A71 Zinc-transporting ATPase; metal homeostasis, metal 99.37
1q8l_A84 Copper-transporting ATPase 1; metal binding protei 99.37
1mwy_A73 ZNTA; open-faced beta-sandwich fold, beta-alpha-be 99.36
1fvq_A72 Copper-transporting ATPase; APO-CCC2A, hydrolase; 99.35
1p6t_A151 Potential copper-transporting ATPase; COPA, P-type 99.34
1opz_A76 Potential copper-transporting ATPase; mutation, fo 99.34
2ofg_X111 Zinc-transporting ATPase; ferredoxin-like fold, be 99.34
1jww_A80 Potential copper-transporting ATPase; beta-alpha-b 99.33
2roe_A66 Heavy metal binding protein; NMR {Thermus thermoph 99.33
1yjr_A75 Copper-transporting ATPase 1; metallochaperone, pr 99.32
1y3j_A77 Copper-transporting ATPase 1; ferrodoxin-like fold 99.32
2ew9_A149 Copper-transporting ATPase 2; copper trafficking, 99.3
2kkh_A95 Putative heavy metal transporter; zinc transport, 99.28
2xmm_A64 SSR2857 protein, ATX1; metal transport, copper hom 99.23
2rop_A202 Copper-transporting ATPase 2; wilson protein, mobi 99.23
2kyz_A67 Heavy metal binding protein; structural genomics, 99.22
1qup_A 222 Superoxide dismutase 1 copper chaperone; two domai 99.19
2k2p_A85 Uncharacterized protein ATU1203; putative metal-bi 99.19
1jk9_B 249 CCS, copper chaperone for superoxide dismutase; pr 99.09
2ew9_A149 Copper-transporting ATPase 2; copper trafficking, 99.04
2aj0_A71 Probable cadmium-transporting ATPase; ferrodoxin-l 99.01
3j09_A 723 COPA, copper-exporting P-type ATPase A; copper tra 98.96
2rop_A202 Copper-transporting ATPase 2; wilson protein, mobi 98.89
1p6t_A151 Potential copper-transporting ATPase; COPA, P-type 98.87
4gwb_A168 Peptide methionine sulfoxide reductase MSRA 3; str 96.23
1fvg_A199 Peptide methionine sulfoxide reductase; oxidoreduc 95.84
1nwa_A203 Peptide methionine sulfoxide reductase MSRA; oxido 95.63
3bqh_A193 PILB, peptide methionine sulfoxide reductase MSRA/ 95.53
1ff3_A211 Peptide methionine sulfoxide reductase; alpha beta 95.51
2j89_A261 Methionine sulfoxide reductase A; MSRA, poplar, ox 95.45
3e0m_A 313 Peptide methionine sulfoxide reductase MSRA/MSRB 1 94.65
2raq_A97 Conserved protein MTH889; alpha-beta protein, stru 93.22
3pim_A187 Peptide methionine sulfoxide reductase; methionine 93.15
2x3d_A96 SSO6206; unknown function; 2.70A {Sulfolobus solfa 92.61
3bpd_A100 Uncharacterized protein; heptamer, Mg+2 ION, PSI-2 91.47
3cq1_A103 Putative uncharacterized protein TTHB138; DTDP-4-k 90.31
3lvj_C82 Sulfurtransferase TUSA; protein-protein complex, s 90.29
1uwd_A103 Hypothetical protein TM0487; similar to PAAD prote 88.48
1jdq_A98 TM006 protein, hypothetical protein TM0983; struct 88.09
3lno_A108 Putative uncharacterized protein; alpha-beta fold, 84.88
2nyt_A190 Probable C->U-editing enzyme apobec-2; cytidine de 84.73
1je3_A97 EC005, hypothetical 8.6 kDa protein in AMYA-FLIE i 83.98
1pav_A78 Hypothetical protein TA1170/TA1414; structural gen 82.72
>4a4j_A Pacszia, cation-transporting ATPase PACS; hydrolase, copper homeostasis, zinc homeostasis, ATX1, metal-transporting atpases; 1.25A {Synechocystis} PDB: 4a48_A 2gcf_A 2xmw_A Back     alignment and structure
Probab=99.54  E-value=6.5e-14  Score=78.58  Aligned_cols=62  Identities=26%  Similarity=0.391  Sum_probs=57.1

Q ss_pred             ceec-CCChhhHHHHHHhhhcCCCceEEEEecCCcEEEEEECCCCCCHHHHHHHHHhCCCceee
Q psy13022          3 YEVF-LPLLDKSSSKSSMIGARTGVDSIKVSLADKEAVITYNPTLVSPKELSEAIYDMGFDTKV   65 (93)
Q Consensus         3 ~~v~-m~c~~C~~~Iek~L~~l~GV~~v~v~l~~~~v~V~~d~~~~~~~~I~~~I~~~Gy~~~~   65 (93)
                      |.|. |.|.+|+..|+++|++++||..+++|+.++++.|.| +...+++.|.++|++.||++.+
T Consensus         6 ~~v~gm~C~~C~~~i~~~l~~~~gv~~~~v~~~~~~~~v~~-~~~~~~~~i~~~i~~~Gy~~~~   68 (69)
T 4a4j_A            6 LQLEGMDCTSCASSIERAIAKVPGVQSCQVNFALEQAVVSY-HGETTPQILTDAVERAGYHARV   68 (69)
T ss_dssp             EEEESCCSHHHHHHHHHHHHTSTTEEEEEEETTTTEEEEEE-CTTCCHHHHHHHHHHTTCEEEE
T ss_pred             EEECCeecHHHHHHHHHHHhcCCCeEEEEEEecCCEEEEEE-CCCCCHHHHHHHHHHcCCceEe
Confidence            4554 999999999999999999999999999999999999 5668999999999999999865
>3dxs_X Copper-transporting ATPase RAN1; CXXC motif, ferredoxin-like fold, ATP- binding, ethylene signaling pathway, hydrolase, ION transport; 1.70A {Arabidopsis thaliana} SCOP: d.58.17.0 Back     alignment and structure
>3iwl_A Copper transport protein ATOX1; beta-alpha-beta-BETA-alpha-beta, cisplatin, platinum, chaperone, ION transport, metal-binding, metal transport; HET: TCE; 1.60A {Homo sapiens} SCOP: d.58.17.1 PDB: 1fe4_A* 1fee_A* 1tl4_A 1tl5_A 2k1r_B 1fe0_A* 3iwx_A 3cjk_A Back     alignment and structure
>1cc8_A Protein (metallochaperone ATX1); copper transport, mercury coordination, metal transport; 1.02A {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1cc7_A 1fd8_A 1fes_A 2ggp_A 3k7r_A Back     alignment and structure
>1osd_A MERP, hypothetical protein MERP; mercury resistance, metal binding protein, perisplasm, structural genomics; 2.00A {Cupriavidus metallidurans} SCOP: d.58.17.1 PDB: 1afi_A 1afj_A 2hqi_A Back     alignment and structure
>3cjk_B Copper-transporting ATPase 1; HAH1, ATP7B, menkes disease, metal homeostasis, chaperone, ION transport, metal- binding, alternative splicing; 1.80A {Homo sapiens} PDB: 2k1r_A Back     alignment and structure
>2xmw_A PACS-N, cation-transporting ATPase PACS; hydrolase, Cu(I)-binding, trafficking; 1.80A {Synechocystis SP} PDB: 2gcf_A Back     alignment and structure
>2crl_A Copper chaperone for superoxide dismutase; SOD1, familial ALS, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2l3m_A Copper-ION-binding protein; structural genomics, center for structural genomics of infec diseases, csgid, metal binding protein; NMR {Bacillus anthracis} Back     alignment and structure
>1cpz_A Protein (COPZ); copper chaperone, metal transport, gene regulation; NMR {Enterococcus hirae} SCOP: d.58.17.1 Back     alignment and structure
>2qif_A Copper chaperone COPZ; tetranuclear Cu(I) cluster; 1.50A {Bacillus subtilis} SCOP: d.58.17.1 PDB: 3i9z_A 1k0v_A 1p8g_A Back     alignment and structure
>3fry_A Probable copper-exporting P-type ATPase A; transport protein, metal binding domain, domain SWAP, ATP-BI cell membrane, copper transport; HET: CIT; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>2g9o_A Copper-transporting ATPase 1; menkes disease, solution structure, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} PDB: 2ga7_A Back     alignment and structure
>1kvi_A Copper-transporting ATPase 1; menkes, Cu-protein, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1kvj_A Back     alignment and structure
>2kt2_A Mercuric reductase; nmera, MERA, HMA domain, mercuric resist metal-binding, oxidoreductase; NMR {Pseudomonas aeruginosa} PDB: 2kt3_A Back     alignment and structure
>1yg0_A COP associated protein; open-faced beta-sandwich, missing C-terminal beta-sheet, Met transport; NMR {Helicobacter pylori} Back     alignment and structure
>1aw0_A Menkes copper-transporting ATPase; copper-binding domain, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 2aw0_A Back     alignment and structure
>2ldi_A Zinc-transporting ATPase; metal homeostasis, metallochaperones, hydrolase; NMR {Synechocystis SP} Back     alignment and structure
>1q8l_A Copper-transporting ATPase 1; metal binding protein; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1s6o_A 1s6u_A Back     alignment and structure
>1mwy_A ZNTA; open-faced beta-sandwich fold, beta-alpha-beta-BETA-alpha- beta, hydrolase; NMR {Escherichia coli} SCOP: d.58.17.1 PDB: 1mwz_A Back     alignment and structure
>1fvq_A Copper-transporting ATPase; APO-CCC2A, hydrolase; NMR {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1fvs_A 2ggp_B Back     alignment and structure
>1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} SCOP: d.58.17.1 d.58.17.1 PDB: 2rml_A Back     alignment and structure
>1opz_A Potential copper-transporting ATPase; mutation, folding, abbab fold, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 1oq3_A 1oq6_A Back     alignment and structure
>1jww_A Potential copper-transporting ATPase; beta-alpha-beta-BETA-alpha-beta, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 2voy_A 1kqk_A Back     alignment and structure
>2roe_A Heavy metal binding protein; NMR {Thermus thermophilus} PDB: 2rog_A Back     alignment and structure
>1yjr_A Copper-transporting ATPase 1; metallochaperone, protein-protein interaction, copper(I), metal homeostasis, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1yjt_A 1yju_A 1yjv_A Back     alignment and structure
>1y3j_A Copper-transporting ATPase 1; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta structure, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1y3k_A Back     alignment and structure
>2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} Back     alignment and structure
>2kkh_A Putative heavy metal transporter; zinc transport, metal binding, metal selectivity, ferredoxin fold, ATP-binding, hydrolase; NMR {Arabidopsis thaliana} Back     alignment and structure
>2xmm_A SSR2857 protein, ATX1; metal transport, copper homeostasis, chaperone, P-type atpas; 1.65A {Synechocystis SP} PDB: 2xmv_A 1sb6_A 2xmj_A 2xmk_A 2xmt_A 2xmu_A Back     alignment and structure
>2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens} Back     alignment and structure
>2kyz_A Heavy metal binding protein; structural genomics, PSI-biology, protein structure initiative, joint for structural genomics, JCSG; NMR {Thermotoga maritima} Back     alignment and structure
>1qup_A Superoxide dismutase 1 copper chaperone; two domains, beta-alpha-beta-BETA-alpha-beta and beta barrel; 1.80A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Back     alignment and structure
>2k2p_A Uncharacterized protein ATU1203; putative metal-binding domain ATU1203, ontario centre for ST proteomics, structural genomics; NMR {Agrobacterium tumefaciens str} Back     alignment and structure
>1jk9_B CCS, copper chaperone for superoxide dismutase; protein-protein complex, heterodimer, metallochaperone, amyotrophic lateral sclerosis; 2.90A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Back     alignment and structure
>2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} Back     alignment and structure
>2aj0_A Probable cadmium-transporting ATPase; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta, metal binding protein, hydrolase; NMR {Listeria monocytogenes} PDB: 2aj1_A Back     alignment and structure
>3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} Back     alignment and structure
>2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens} Back     alignment and structure
>1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} SCOP: d.58.17.1 d.58.17.1 PDB: 2rml_A Back     alignment and structure
>4gwb_A Peptide methionine sulfoxide reductase MSRA 3; structural genomics, protein structure initiative, nysgrc, R PSI-biology; 1.20A {Sinorhizobium meliloti} Back     alignment and structure
>1fvg_A Peptide methionine sulfoxide reductase; oxidoreductase; 1.60A {Bos taurus} SCOP: d.58.28.1 PDB: 1fva_A 2l90_A* Back     alignment and structure
>1nwa_A Peptide methionine sulfoxide reductase MSRA; oxidoreductase, product complex, structural genomics, PSI, protein structure initiative; 1.50A {Mycobacterium tuberculosis} SCOP: d.58.28.1 Back     alignment and structure
>3bqh_A PILB, peptide methionine sulfoxide reductase MSRA/MSRB; methionine sulfoxide reductase A, oxidized form, elect transport; 1.95A {Neisseria meningitidis} PDB: 3bqe_A 3bqf_A* 3bqg_A Back     alignment and structure
>1ff3_A Peptide methionine sulfoxide reductase; alpha beta roll, PMSR, MSRA, oxidoreductase; 1.90A {Escherichia coli} SCOP: d.58.28.1 PDB: 2gt3_A 2iem_A Back     alignment and structure
>2j89_A Methionine sulfoxide reductase A; MSRA, poplar, oxidoreductase; 1.7A {Populus trichocarpa} Back     alignment and structure
>3e0m_A Peptide methionine sulfoxide reductase MSRA/MSRB 1; fusion, msrab, linker, hinge, cell membrane, membrane, multifunctional enzyme, oxidoreductase; 2.40A {Streptococcus pneumoniae} Back     alignment and structure
>2raq_A Conserved protein MTH889; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 3.11A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: d.58.61.1 Back     alignment and structure
>3pim_A Peptide methionine sulfoxide reductase; methionine-S-sulfoxide reductase, oxidoreductase; 1.90A {Saccharomyces cerevisiae} PDB: 3pil_A 3pin_B Back     alignment and structure
>2x3d_A SSO6206; unknown function; 2.70A {Sulfolobus solfataricus} Back     alignment and structure
>3bpd_A Uncharacterized protein; heptamer, Mg+2 ION, PSI-2, NYSGXRC, structural genom protein structure initiative; 2.80A {Archaeoglobus fulgidus dsm 4304} SCOP: d.58.61.1 Back     alignment and structure
>3cq1_A Putative uncharacterized protein TTHB138; DTDP-4-keto-L-rhamnose reductase, plasmid, oxidoreductase, structural genomics, NPPSFA; 1.90A {Thermus thermophilus} PDB: 2cu6_A 3cq2_A 3cq3_A* Back     alignment and structure
>3lvj_C Sulfurtransferase TUSA; protein-protein complex, structural genomics, montreal-kings bacterial structural genomics initiative, BSGI; HET: PLP; 2.44A {Escherichia coli} SCOP: d.68.3.3 PDB: 3lvk_B* 1dcj_A Back     alignment and structure
>1uwd_A Hypothetical protein TM0487; similar to PAAD protein, alpha/beta fold,structural genomics joint center for structural genomics, JCSG; NMR {Thermotoga maritima} SCOP: d.52.8.2 PDB: 1wcj_A Back     alignment and structure
>1jdq_A TM006 protein, hypothetical protein TM0983; structural genomics; NMR {Thermotoga maritima} SCOP: d.68.3.3 Back     alignment and structure
>3lno_A Putative uncharacterized protein; alpha-beta fold, structural genomics, center for structural genomics of infectious diseases, csgid; 2.10A {Bacillus anthracis} SCOP: d.52.8.0 Back     alignment and structure
>2nyt_A Probable C->U-editing enzyme apobec-2; cytidine deaminase, zinc-ION binding, hydrolase; 2.50A {Homo sapiens} PDB: 2rpz_A Back     alignment and structure
>1je3_A EC005, hypothetical 8.6 kDa protein in AMYA-FLIE intergenic region; mixed alpha-beta structure, structural genomics; NMR {Escherichia coli} SCOP: d.68.3.3 Back     alignment and structure
>1pav_A Hypothetical protein TA1170/TA1414; structural genomics, structure, fast NMR, semiautomated analysis; NMR {Thermoplasma acidophilum} SCOP: d.68.3.3 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 93
d1osda_72 d.58.17.1 (A:) Mercuric ion binding protein MerP { 1e-09
d1cpza_68 d.58.17.1 (A:) Copper chaperone {Enterococcus hira 1e-09
d1kvja_79 d.58.17.1 (A:) Menkes copper-transporting ATPase { 2e-09
d2aw0a_72 d.58.17.1 (A:) Menkes copper-transporting ATPase { 3e-09
d1p6ta172 d.58.17.1 (A:1-72) Potential copper-translocating 3e-08
d1p6ta279 d.58.17.1 (A:73-151) Potential copper-translocatin 4e-08
d2qifa169 d.58.17.1 (A:1-69) Copper chaperone {Bacillus subt 4e-08
d2ggpb172 d.58.17.1 (B:1-72) Copper transporter domain ccc2a 2e-07
d1q8la_84 d.58.17.1 (A:) Menkes copper-transporting ATPase { 3e-06
d1mwza_73 d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, 2e-05
d1qupa272 d.58.17.1 (A:2-73) Copper chaperone for superoxide 0.002
d1sb6a_64 d.58.17.1 (A:) Copper chaperone {Synechocystis sp. 0.003
>d1osda_ d.58.17.1 (A:) Mercuric ion binding protein MerP {Ralstonia metallidurans CH34 [TaxId: 266264]} Length = 72 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: HMA, heavy metal-associated domain
family: HMA, heavy metal-associated domain
domain: Mercuric ion binding protein MerP
species: Ralstonia metallidurans CH34 [TaxId: 266264]

 Score = 47.8 bits (114), Expect = 1e-09
 Identities = 13/43 (30%), Positives = 26/43 (60%)

Query: 25 GVDSIKVSLADKEAVITYNPTLVSPKELSEAIYDMGFDTKVTQ 67
          GV  + V+   ++AV+T++    S ++L++A  D G+ + V Q
Sbjct: 30 GVSKVDVTFETRQAVVTFDDAKTSVQKLTKATADAGYPSSVKQ 72
>d1cpza_ d.58.17.1 (A:) Copper chaperone {Enterococcus hirae [TaxId: 1354]} Length = 68 Back     information, alignment and structure
>d1kvja_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d2aw0a_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Length = 72 Back     information, alignment and structure
>d1p6ta1 d.58.17.1 (A:1-72) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Length = 72 Back     information, alignment and structure
>d1p6ta2 d.58.17.1 (A:73-151) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Length = 79 Back     information, alignment and structure
>d2qifa1 d.58.17.1 (A:1-69) Copper chaperone {Bacillus subtilis, CopZ [TaxId: 1423]} Length = 69 Back     information, alignment and structure
>d2ggpb1 d.58.17.1 (B:1-72) Copper transporter domain ccc2a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 72 Back     information, alignment and structure
>d1q8la_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d1mwza_ d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 73 Back     information, alignment and structure
>d1qupa2 d.58.17.1 (A:2-73) Copper chaperone for superoxide dismutase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 72 Back     information, alignment and structure
>d1sb6a_ d.58.17.1 (A:) Copper chaperone {Synechocystis sp. pcc 6803, Scatx1 [TaxId: 1148]} Length = 64 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query93
d1cpza_68 Copper chaperone {Enterococcus hirae [TaxId: 1354] 99.74
d2aw0a_72 Menkes copper-transporting ATPase {Human (Homo sap 99.7
d1osda_72 Mercuric ion binding protein MerP {Ralstonia metal 99.7
d2qifa169 Copper chaperone {Bacillus subtilis, CopZ [TaxId: 99.69
d1qupa272 Copper chaperone for superoxide dismutase, N-termi 99.69
d1p6ta279 Potential copper-translocating P-type ATPase CopA 99.68
d2ggpb172 Copper transporter domain ccc2a {Baker's yeast (Sa 99.68
d1q8la_84 Menkes copper-transporting ATPase {Human (Homo sap 99.67
d1fe0a_66 ATX1 metallochaperone protein (ATOX1) {Human (Homo 99.66
d1kvja_79 Menkes copper-transporting ATPase {Human (Homo sap 99.66
d1p6ta172 Potential copper-translocating P-type ATPase CopA 99.65
d1cc8a_72 ATX1 metallochaperone protein (ATOX1) {Baker's yea 99.63
d1mwza_73 Metal ion-transporting ATPase ZntA, N-terminal dom 99.61
d1sb6a_64 Copper chaperone {Synechocystis sp. pcc 6803, Scat 99.52
d1nwaa_168 Peptide methionine sulfoxide reductase {Mycobacter 95.4
d1ff3a_211 Peptide methionine sulfoxide reductase {Escherichi 95.3
d1fvga_192 Peptide methionine sulfoxide reductase {Cow (Bos t 94.82
d2raqa193 Uncharacterized protein MTH889 {Methanobacterium t 93.3
d1dcja_81 SirA {Escherichia coli [TaxId: 562]} 92.95
d1je3a_97 hypothetical protein YedF (EC005) {Escherichia col 91.7
d1jdqa_98 Hypothetical protein TM0983 {Thermotoga maritima [ 90.4
d3bpda191 Uncharacterized protein AF1549 {Archaeoglobus fulg 90.19
d1uwda_102 Hypothetical protein TM0487 {Thermotoga maritima [ 89.58
d2cu6a191 Hypothetical protein TTHB138 {Thermus thermophilus 89.23
d2phcb284 Uncharacterized protein PH0987 {Pyrococcus horikos 85.07
d1pava_78 Hypothetical protein Ta1170/Ta1414 {Archaeon Therm 82.86
>d1cpza_ d.58.17.1 (A:) Copper chaperone {Enterococcus hirae [TaxId: 1354]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: HMA, heavy metal-associated domain
family: HMA, heavy metal-associated domain
domain: Copper chaperone
species: Enterococcus hirae [TaxId: 1354]

Probab=99.74  E-value=9e-18  Score=95.27  Aligned_cols=64  Identities=23%  Similarity=0.458  Sum_probs=60.2

Q ss_pred             ceec-CCChhhHHHHHHhhhcCCCceEEEEecCCcEEEEEECCCCCCHHHHHHHHHhCCCceeee
Q psy13022          3 YEVF-LPLLDKSSSKSSMIGARTGVDSIKVSLADKEAVITYNPTLVSPKELSEAIYDMGFDTKVT   66 (93)
Q Consensus         3 ~~v~-m~c~~C~~~Iek~L~~l~GV~~v~v~l~~~~v~V~~d~~~~~~~~I~~~I~~~Gy~~~~~   66 (93)
                      |.|. |+|.+|+.+|+++|++++||.+++||+.++++.|.||+..+++++|.++|+++||++.++
T Consensus         4 l~V~GM~C~~C~~~Ie~~l~~~~GV~~v~V~~~~~~v~v~~d~~~~~~~~i~~~i~~~Gy~a~vi   68 (68)
T d1cpza_           4 FSVKGMSCNHCVARIEEAVGRISGVKKVKVQLKKEKAVVKFDEANVQATEICQAINELGYQAEVI   68 (68)
T ss_dssp             EEESCCCSSSHHHHHHHHHHTSTTEEEEEEETTTTEEEEEECTTTCCHHHHHHHHHTTSSCEEEC
T ss_pred             EEECCeEcHHHHHHHHHHHhcCCCcEEEEEECCCCEEEEEECCCCCCHHHHHHHHHhhCCCcEEC
Confidence            5666 999999999999999999999999999999999999998899999999999999998753
>d2aw0a_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1osda_ d.58.17.1 (A:) Mercuric ion binding protein MerP {Ralstonia metallidurans CH34 [TaxId: 266264]} Back     information, alignment and structure
>d2qifa1 d.58.17.1 (A:1-69) Copper chaperone {Bacillus subtilis, CopZ [TaxId: 1423]} Back     information, alignment and structure
>d1qupa2 d.58.17.1 (A:2-73) Copper chaperone for superoxide dismutase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p6ta2 d.58.17.1 (A:73-151) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2ggpb1 d.58.17.1 (B:1-72) Copper transporter domain ccc2a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q8la_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fe0a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Human (Homo sapiens), HAH1 [TaxId: 9606]} Back     information, alignment and structure
>d1kvja_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p6ta1 d.58.17.1 (A:1-72) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1cc8a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mwza_ d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sb6a_ d.58.17.1 (A:) Copper chaperone {Synechocystis sp. pcc 6803, Scatx1 [TaxId: 1148]} Back     information, alignment and structure
>d1nwaa_ d.58.28.1 (A:) Peptide methionine sulfoxide reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ff3a_ d.58.28.1 (A:) Peptide methionine sulfoxide reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fvga_ d.58.28.1 (A:) Peptide methionine sulfoxide reductase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2raqa1 d.58.61.1 (A:3-95) Uncharacterized protein MTH889 {Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1dcja_ d.68.3.3 (A:) SirA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1je3a_ d.68.3.3 (A:) hypothetical protein YedF (EC005) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jdqa_ d.68.3.3 (A:) Hypothetical protein TM0983 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d3bpda1 d.58.61.1 (A:1-91) Uncharacterized protein AF1549 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1uwda_ d.52.8.2 (A:) Hypothetical protein TM0487 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2cu6a1 d.52.8.2 (A:6-96) Hypothetical protein TTHB138 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2phcb2 d.74.5.1 (B:2-85) Uncharacterized protein PH0987 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1pava_ d.68.3.3 (A:) Hypothetical protein Ta1170/Ta1414 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure