Diaphorina citri psyllid: psy13024


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70-----
MAATVFVQPLDLIKNRMQLDKAKEYRSSIQAFTTILRKEGVFAMYNGLSAGLLRQATYTTTRLGTYNLLLNKFKA
cCEEEEcccHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHcc
MAATVFVQPLDLIKNRMQLDKAKEYRSSIQAFTTILRKEGVFAMYNGLSAGLLRQATYTTTRLGTYNLLLNKFK*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAATVFVQPLDLIKNRMQLDKAKEYRSSIQAFTTILRKEGVFAMYNGLSAGLLRQATYTTTRLGTYNLLLNKFKA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Mitochondrial dicarboxylate/tricarboxylate transporter DTC Catalyzes the transport of dicarboxylates, such as oxoglutarate, oxaloacetate, malate, and succinate, and of tricarboxylates, such as citrate, isocitrate, cis-aconitate, and trans-aconitate by a counter-exchange mechanism across the inner mitochondrial membrane. Substrate preference in reconstituted proteoliposomes is oxaloacetate > malonate > malate > maleate > succinate > oxoglutarate > citrate > trans-aconitate > cis-aconitate > sulfate > isocitrate. May be important for plant metabolic functions requiring organic acid flux to or from the mitochondria, such as nitrogen assimilation, export of reducing equivalents from the mitochondria, and fatty acid elongation.confidentQ9C5M0
Mitochondrial 2-oxoglutarate/malate carrier protein Catalyzes the transport of 2-oxoglutarate across the inner mitochondrial membrane in an electroneutral exchange for malate or other dicarboxylic acids, and plays an important role in several metabolic processes, including the malate-aspartate shuttle, the oxoglutarate/isocitrate shuttle, in gluconeogenesis from lactate, and in nitrogen metabolism.confidentQ02978
Mitochondrial 2-oxoglutarate/malate carrier protein Catalyzes the transport of 2-oxoglutarate across the inner mitochondrial membrane in an electroneutral exchange for malate or other dicarboxylic acids, and plays an important role in several metabolic processes, including the malate-aspartate shuttle, the oxoglutarate/isocitrate shuttle, in gluconeogenesis from lactate, and in nitrogen metabolism.confidentP22292

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0006839 [BP]mitochondrial transportprobableGO:0009987, GO:0046907, GO:0006810, GO:0044765, GO:0008150, GO:0051649, GO:0044763, GO:0051234, GO:0051179, GO:0044699, GO:0051641
GO:0009941 [CC]chloroplast envelopeprobableGO:0009526, GO:0005737, GO:0009536, GO:0005575, GO:0043231, GO:0044464, GO:0043229, GO:0031967, GO:0031975, GO:0044446, GO:0044444, GO:0005623, GO:0044435, GO:0044434, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0009507
GO:0015117 [MF]thiosulfate transmembrane transporter activityprobableGO:0022891, GO:1901682, GO:0005215, GO:0008509, GO:0015075, GO:0022857, GO:0022892, GO:0003674, GO:0015103
GO:0071423 [BP]malate transmembrane transportprobableGO:0009987, GO:0006820, GO:0051234, GO:0015849, GO:0006811, GO:0006810, GO:0015711, GO:0051179, GO:0008150, GO:0034220, GO:0044765, GO:0044763, GO:0071702, GO:0006835, GO:0046942, GO:0015743, GO:0055085, GO:0044699, GO:0015740
GO:1901677 [MF]phosphate transmembrane transporter activityprobableGO:0005215, GO:0022857, GO:0003674
GO:0035674 [BP]tricarboxylic acid transmembrane transportprobableGO:0006842, GO:0009987, GO:0006820, GO:0015849, GO:0006811, GO:0006810, GO:0015711, GO:0051179, GO:0034220, GO:0044765, GO:0044763, GO:0071702, GO:0008150, GO:0051234, GO:0055085, GO:0044699, GO:0046942
GO:0009506 [CC]plasmodesmaprobableGO:0055044, GO:0005575, GO:0030054, GO:0005911
GO:0005811 [CC]lipid particleprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0015865 [BP]purine nucleotide transportprobableGO:0015931, GO:0006810, GO:0015748, GO:0006862, GO:0071705, GO:0044765, GO:0008150, GO:0071702, GO:0051234, GO:0051179, GO:0044699
GO:0042221 [BP]response to chemical stimulusprobableGO:0050896, GO:0008150
GO:0005774 [CC]vacuolar membraneprobableGO:0005737, GO:0005575, GO:0031090, GO:0005773, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044437, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0046872 [MF]metal ion bindingprobableGO:0043169, GO:0003674, GO:0005488, GO:0043167
GO:0035435 [BP]phosphate ion transmembrane transportprobableGO:0009987, GO:0006811, GO:0006810, GO:0006817, GO:0044765, GO:0051179, GO:0008150, GO:0034220, GO:0006820, GO:0044763, GO:0015698, GO:0051234, GO:0055085, GO:0044699
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0015116 [MF]sulfate transmembrane transporter activityprobableGO:0022891, GO:1901682, GO:0005215, GO:0008509, GO:0015075, GO:0022857, GO:0022892, GO:0003674, GO:0015103
GO:0005743 [CC]mitochondrial inner membraneprobableGO:0019866, GO:0031975, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0044446, GO:0031090, GO:0016020, GO:0005740, GO:0005739, GO:0031967, GO:0031966, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044429, GO:0044424, GO:0044422
GO:0008272 [BP]sulfate transportprobableGO:0006811, GO:0006810, GO:0072348, GO:0044765, GO:0006820, GO:0008150, GO:0015698, GO:0051234, GO:0051179, GO:0044699
GO:0005618 [CC]cell wallprobableGO:0005575, GO:0071944, GO:0044464, GO:0005623, GO:0030312
GO:0015709 [BP]thiosulfate transportprobableGO:0006811, GO:0006810, GO:0072348, GO:0044765, GO:0006820, GO:0008150, GO:0015698, GO:0051234, GO:0051179, GO:0044699
GO:0015141 [MF]succinate transmembrane transporter activityprobableGO:0022891, GO:0022892, GO:0005342, GO:0015556, GO:0005310, GO:0008509, GO:0015075, GO:0008514, GO:0022857, GO:0003674, GO:0005215, GO:0046943
GO:0015140 [MF]malate transmembrane transporter activityprobableGO:0022891, GO:0022892, GO:0005342, GO:0015556, GO:0005310, GO:0008509, GO:0015075, GO:0008514, GO:0022857, GO:0003674, GO:0005215, GO:0046943
GO:0015142 [MF]tricarboxylic acid transmembrane transporter activityprobableGO:0022891, GO:0022892, GO:0005342, GO:0008514, GO:0005215, GO:0008509, GO:0015075, GO:0022857, GO:0003674, GO:0046943
GO:0015297 [MF]antiporter activityprobableGO:0005215, GO:0022857, GO:0015291, GO:0003674, GO:0022804
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0015744 [BP]succinate transportprobableGO:0051234, GO:0015849, GO:0006811, GO:0006810, GO:0015711, GO:0044765, GO:0006820, GO:0006835, GO:0071702, GO:0008150, GO:0015740, GO:0051179, GO:0044699, GO:0046942

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2LCK, chain A
Confidence level:very confident
Coverage over the Query: 2-74
View the alignment between query and template
View the model in PyMOL