Diaphorina citri psyllid: psy1303


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200------
GCGGTSTILTVHNCLYAGLINKFGTKKQKETYLPSFVDGTNVGCFGISEPGSGSDAANMLTTARKESDHWVLNGTKSWITNGYEAKAFVCIAQADKSKKHKGITAFIIPMDSPGLSLGKKEDKLGIRASSTCNVILEDVKIPLDSVLGKEGEGFKVGLTGIDCARIGMASQGIGIAQAAFDCAMEYAGKRIAFGAPILKLQAVQLP
ccccEEEEEEEEccccHHHHHHcccHHHHHHcccccccccCEEEEEcccccccccccccEEEEEEcccEEEEcccEEEEEccccccEEEEEEEcccccccccEEEEEEccccccccccccccccccccccccEEEEccccccccccccccccHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccc
*CGGTSTILTVHNCLYAGLINKFGTKKQKETYLPSFVDGTNVGCFGISEPGSGSDAANMLTTARKESDHWVLNGTKSWITNGYEAKAFVCIAQADKSKKHKGITAFIIPMDSPGLSLGKKEDKLGIRASSTCNVILEDVKIPLDSVLGKEGEGFKVGLTGIDCARIGMASQGIGIAQAAFDCAMEYAGKRIAFGAPILKLQAVQLP
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
GCGGTSTILTVHNCLYAGLINKFGTKKQKETYLPSFVDGTNVGCFGISEPGSGSDAANMLTTARKESDHWVLNGTKSWITNGYEAKAFVCIAQADKSKKHKGITAFIIPMDSPGLSLGKKEDKLGIRASSTCNVILEDVKIPLDSVLGKEGEGFKVGLTGIDCARIGMASQGIGIAQAAFDCAMEYAGKRIAFGAPILKLQAVQLP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Short-chain specific acyl-CoA dehydrogenase, mitochondrial confidentQ07417
Short-chain specific acyl-CoA dehydrogenase, mitochondrial confidentQ5RAS0
Short-chain specific acyl-CoA dehydrogenase, mitochondrial confidentP79273

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005875 [CC]microtubule associated complexprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0005618 [CC]cell wallprobableGO:0005575, GO:0071944, GO:0044464, GO:0005623, GO:0030312
GO:0033539 [BP]fatty acid beta-oxidation using acyl-CoA dehydrogenaseprobableGO:0034440, GO:0006631, GO:0006635, GO:0019752, GO:0044248, GO:0009062, GO:0044281, GO:0044282, GO:0044242, GO:0044712, GO:1901575, GO:0030258, GO:0016042, GO:0071704, GO:0006629, GO:0009987, GO:0044710, GO:0032787, GO:0008150, GO:0008152, GO:0072329, GO:0043436, GO:0019395, GO:0044255, GO:0009056, GO:0055114, GO:0044238, GO:0006082, GO:0046395, GO:0016054, GO:0044237
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0003995 [MF]acyl-CoA dehydrogenase activityprobableGO:0003824, GO:0016627, GO:0003674, GO:0016491
GO:0000062 [MF]fatty-acyl-CoA bindingprobableGO:0043168, GO:0050662, GO:0043167, GO:0003674, GO:0005488, GO:0048037
GO:0046359 [BP]butyrate catabolic processprobableGO:0006631, GO:0019752, GO:0044248, GO:0009062, GO:0044281, GO:0044282, GO:0044242, GO:0044712, GO:1901575, GO:0016042, GO:0071704, GO:0019626, GO:0019605, GO:0006629, GO:0009987, GO:0044710, GO:0032787, GO:0008150, GO:0008152, GO:0072329, GO:0043436, GO:0044255, GO:0009056, GO:0044238, GO:0006082, GO:0046395, GO:0016054, GO:0044237, GO:0046459
GO:0051289 [BP]protein homotetramerizationprobableGO:0051259, GO:0022607, GO:0071822, GO:0070271, GO:0043933, GO:0006461, GO:0051260, GO:0051262, GO:0065003, GO:0044085, GO:0008150, GO:0016043, GO:0071840
GO:0031966 [CC]mitochondrial membraneprobableGO:0005737, GO:0005575, GO:0031090, GO:0043229, GO:0016020, GO:0044464, GO:0044444, GO:0031967, GO:0031975, GO:0044446, GO:0005740, GO:0005739, GO:0044429, GO:0044424, GO:0005623, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0050660 [MF]flavin adenine dinucleotide bindingprobableGO:0043168, GO:0050662, GO:0097159, GO:0043167, GO:0036094, GO:0048037, GO:0005488, GO:0003674, GO:0000166, GO:1901363, GO:1901265
GO:0005759 [CC]mitochondrial matrixprobableGO:0005737, GO:0005575, GO:0043231, GO:0043233, GO:0031974, GO:0044464, GO:0043229, GO:0005739, GO:0005622, GO:0044446, GO:0070013, GO:0044444, GO:0044429, GO:0044424, GO:0005623, GO:0043227, GO:0043226, GO:0044422
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1BUC, chain A
Confidence level:very confident
Coverage over the Query: 2-206
View the alignment between query and template
View the model in PyMOL