Diaphorina citri psyllid: psy13053

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240--

CNLKQVDIRGISTSATLLKHVQAARYKTSKKGDKPLTYEMSGPPHTIAHIKSWNSWNTCNMLDGLRPSETAVEDEFIQIIIKRQHNIIRIGGIVERAIHPRKIYFLIGYTEELLSFWLQCPVKLELQTVENKCTPENMATAGFYSISKLRNDTSVKCFCCLKELDGWESMDDPWEEHKRHQKDCPYIKLNTVEQQWTLEEWIDLQQAMAVKLLGTCAEVRSVEYCYQRNWHKRAVTSVIGLG

ccccccccEEEEEHHHHHHHccccEEECccccccccCEEccccccccEEEccccccccccccccccccccccHHHHHHHHHHHccccccHHHHHHcccccccccccccHHHHHHHHHccccccccccccccccccccccccCEEEcccccccccEEEEcccccccccccccccHHHHHHcccccccEEEccccccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHccc

***********STSATLLKHVQAARYKTSKKGDKPLTYEMSGPPHTIAHIKSWNSWNTCNMLDGLRPSETAVEDEFIQIIIKRQHNIIRIGGIVERAIHPRKIYFLIGYTEELLSFWLQCPVKLELQTVENKCTPENMATAGFYSISKLRNDTSVKCFCCLKELDGWESMDDPWEEHKRHQKDCPYIKLNTVEQQWTLEEWIDLQQAMAVKLLGTCAEVRSVEYCYQRNWHKRAVTSVIGL*

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
28S ribosomal protein S24, mitochondrial		confident	Q9VCC3

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0043066 [BP]	negative regulation of apoptotic process	probable	GO:0043069, GO:0050794, GO:0008150, GO:0043067, GO:0065007, GO:0060548, GO:0048519, GO:0010941, GO:0042981, GO:0050789, GO:0048523
GO:0043231 [CC]	intracellular membrane-bounded organelle	probable	GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0044267 [BP]	cellular protein metabolic process	probable	GO:0044238, GO:0044260, GO:0019538, GO:0009987, GO:0044237, GO:0043170, GO:0071704, GO:0008150, GO:0008152
GO:0044446 [CC]	intracellular organelle part	probable	GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043226, GO:0044422
GO:0044444 [CC]	cytoplasmic part	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0005694 [CC]	chromosome	probable	GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0032991 [CC]	macromolecular complex	probable	GO:0005575

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2QFA, chain A
Confidence level:very confident
Coverage over the Query: 107-210
View the alignment between query and template
View the model in PyMOL

Template: 1G73, chain C
Confidence level:very confident
Coverage over the Query: 35-107
View the alignment between query and template
View the model in PyMOL