Psyllid ID: psy13053

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240--
CNLKQVDIRGISTSATLLKHVQAARYKTSKKGDKPLTYEMSGPPHTIAHIKSWNSWNTCNMLDGLRPSETAVEDEFIQIIIKRQHNIIRIGGIVERAIHPRKIYFLIGYTEELLSFWLQCPVKLELQTVENKCTPENMATAGFYSISKLRNDTSVKCFCCLKELDGWESMDDPWEEHKRHQKDCPYIKLNTVEQQWTLEEWIDLQQAMAVKLLGTCAEVRSVEYCYQRNWHKRAVTSVIGLG
ccccccccEEEEEHHHHHHHccccEEEEccccccccEEEccccccccEEEccccccccccccccccccccccHHHHHHHHHHHccccccHHHHHHcccccccccccccHHHHHHHHHccccccccccccccccccccccccEEEEcccccccccEEEEcccccccccccccccHHHHHHcccccccEEEccccccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHccc
ccHHHHHHHccEEcccEEEEEEEEEEEccccccccccHHccccccHEEEEccccccccccccccccccHHHHHHHHHHHHHHHHccccEHHHHHHcccccccccccccccHHHHHHHHcccHHHHHHHccccccHHHHHHccEEEccccccccEEEEEEcccEEccccccccHHHHHHHHcccccEEEEccccccccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcc
cnlkqvdirgISTSATLLKHVQAARYktskkgdkpltyemsgpphtiahikswnswntcnmldglrpsetavEDEFIQIIIKRQHNIIRIGGIveraihprkIYFLIGYTEELLSFWLqcpvklelqtvenkctpenmatagFYSIsklrndtsvkcfcclkeldgwesmddpweehkrhqkdcpyiklNTVEQQWTLEEWIDLQQAMAVKLLGTCAEVRSVEycyqrnwhKRAVTSVIGLG
cnlkqvdirgistsatllkhvqaaryktskkgdkpltYEMSGPPHTIAHIKSWNSWNTCNMLDGLRPSETAVEDEFIQIIIKRQHNIIRIGGIVERAIHPRKIYFLIGYTEELLSFWLQCPVKLELQTvenkctpenMATAGFysisklrndtSVKCFCCLKELDGWESMDDPWEEHKrhqkdcpyiKLNTVEQQWTLEEWIDLQQAMAVKLLGTCAEVRSVeycyqrnwhkravtsviglg
CNLKQVDIRGISTSATLLKHVQAARYKTSKKGDKPLTYEMSGPPHTIAHIKSWNSWNTCNMLDGLRPSETAVEDEFiqiiikrqhniiriGGIVERAIHPRKIYFLIGYTEELLSFWLQCPVKLELQTVENKCTPENMATAGFYSISKLRNDTSVKCFCCLKELDGWESMDDPWEEHKRHQKDCPYIKLNTVEQQWTLEEWIDLQQAMAVKLLGTCAEVRSVEYCYQRNWHKRAVTSVIGLG
***************TLLKHV***********************HTIAHIKSWNSWNTCNMLDGLRPSETAVEDEFIQIIIKRQHNIIRIGGIVERAIHPRKIYFLIGYTEELLSFWLQCPVKLELQTVENKCTPENMATAGFYSISKLRNDTSVKCFCCLKELDGWESMDDPWEEHKRHQKDCPYIKLNTVEQQWTLEEWIDLQQAMAVKLLGTCAEVRSVEYCYQRNWHKRAVTSVI***
***********STSATLLKHVQAARYKTSKKGDKPLTYEMSGPPHTIAHIKSWNSWNT***************DEFIQIIIKRQHNIIRIGGIVE**IHPRKIYFLIGYTEELLSFWLQCPVKLELQTVENKCTPENMATAGFYSISKLRNDTSVKCFCCLKELDGWESMDDPWEEHKRHQKDCPYIKLNTVEQQWTLEEWIDLQQAMA**************************TSVIGL*
CNLKQVDIRGISTSATLLKHVQAARYKTSKKGDKPLTYEMSGPPHTIAHIKSWNSWNTCNMLDGLRPSETAVEDEFIQIIIKRQHNIIRIGGIVERAIHPRKIYFLIGYTEELLSFWLQCPVKLELQTVENKCTPENMATAGFYSISKLRNDTSVKCFCCLKELDGWESMDD*********KDCPYIKLNTVEQQWTLEEWIDLQQAMAVKLLGTCAEVRSVEYCYQRNWHKRAVTSVIGLG
CNLKQVDIRGISTSATLLKHVQAARYKTSKKGDKPLTYEMSGPPHTIAHIKSWNSWNTCNMLDGLRPSETAVEDEFIQIIIKRQHNIIRIGGIVERAIHPRKIYFLIGYTEELLSFWLQCPVKLELQTVENKCTPENMATAGFYSISKLRNDTSVKCFCCLKELDGWESMDDPWEEHKRHQKDCPYIKLNTVEQQWTLEEWIDLQQAMAVKLLGTCAEVRSVEYCYQRNWHKRAVT******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
CNLKQVDIRGISTSATLLKHVQAARYKTSKKGDKPLTYEMSGPPHTIAHIKSWNSWNTCNMLDGLRPSETAVEDEFIQIIIKRQHNIIRIGGIVERAIHPRKIYFLIGYTEELLSFWLQCPVKLELQTVENKCTPENMATAGFYSISKLRNDTSVKCFCCLKELDGWESMDDPWEEHKRHQKDCPYIKLNTVEQQWTLEEWIDLQQAMAVKLLGTCAEVRSVEYCYQRNWHKRAVTSVIGLG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query242 2.2.26 [Sep-21-2011]
Q9VCC3165 28S ribosomal protein S24 yes N/A 0.533 0.781 0.548 6e-40
Q6NTS3170 28S ribosomal protein S24 N/A N/A 0.528 0.752 0.458 1e-23
Q3B8K3170 28S ribosomal protein S24 N/A N/A 0.528 0.752 0.458 1e-23
Q96EL2167 28S ribosomal protein S24 yes N/A 0.504 0.730 0.420 5e-21
Q502C1163 28S ribosomal protein S24 yes N/A 0.508 0.754 0.410 7e-21
Q2M2T7167 28S ribosomal protein S24 yes N/A 0.504 0.730 0.413 1e-19
Q9CQV5167 28S ribosomal protein S24 yes N/A 0.504 0.730 0.398 1e-18
Q61T16166 28S ribosomal protein S24 N/A N/A 0.512 0.746 0.367 1e-15
Q688C0164 28S ribosomal protein S24 yes N/A 0.504 0.743 0.351 1e-14
Q804H7157 Baculoviral IAP repeat-co N/A N/A 0.330 0.509 0.444 5e-13
>sp|Q9VCC3|RT24_DROME 28S ribosomal protein S24, mitochondrial OS=Drosophila melanogaster GN=mRpS24 PE=3 SV=1 Back     alignment and function desciption
 Score =  164 bits (415), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 79/144 (54%), Positives = 101/144 (70%), Gaps = 15/144 (10%)

Query: 3   LKQVDIRGISTSATLLKHVQAARYKTSKKGDKPLTYEMSGPPHTIAHIKSWNSWNTCNML 62
           ++Q+   G  TS+   + VQ+ RY+ + K ++PLTYEM+ PPH I H KSWNSWNT  M 
Sbjct: 15  VQQLSRSGFHTSSVCCR-VQSGRYRITTKRNRPLTYEMANPPHFIGHRKSWNSWNTSTMK 73

Query: 63  DGLRPSETAVEDEFI--------------QIIIKRQHNIIRIGGIVERAIHPRKIYFLIG 108
           D LRPS+TA+ED FI              ++IIKRQHN IRI  ++ +AI PRK+YFLIG
Sbjct: 74  DALRPSQTAIEDVFIRKFVTGTWHALVCSEVIIKRQHNTIRIAALIRQAITPRKMYFLIG 133

Query: 109 YTEELLSFWLQCPVKLELQTVENK 132
           YTEELLS+W+QCPV LELQTV +K
Sbjct: 134 YTEELLSYWMQCPVTLELQTVGDK 157

Drosophila melanogaster (taxid: 7227)
>sp|Q6NTS3|RT24A_XENLA 28S ribosomal protein S24-A, mitochondrial OS=Xenopus laevis GN=mrps24-a PE=2 SV=1 Back     alignment and function description
>sp|Q3B8K3|RT24B_XENLA 28S ribosomal protein S24-B, mitochondrial OS=Xenopus laevis GN=mrps24-b PE=2 SV=1 Back     alignment and function description
>sp|Q96EL2|RT24_HUMAN 28S ribosomal protein S24, mitochondrial OS=Homo sapiens GN=MRPS24 PE=1 SV=1 Back     alignment and function description
>sp|Q502C1|RT24_DANRE 28S ribosomal protein S24, mitochondrial OS=Danio rerio GN=mrps24 PE=2 SV=1 Back     alignment and function description
>sp|Q2M2T7|RT24_BOVIN 28S ribosomal protein S24, mitochondrial OS=Bos taurus GN=MRPS24 PE=1 SV=1 Back     alignment and function description
>sp|Q9CQV5|RT24_MOUSE 28S ribosomal protein S24, mitochondrial OS=Mus musculus GN=Mrps24 PE=2 SV=1 Back     alignment and function description
>sp|Q61T16|RT24_CAEBR 28S ribosomal protein S24, mitochondrial OS=Caenorhabditis briggsae GN=CBG05943 PE=3 SV=1 Back     alignment and function description
>sp|Q688C0|RT24_CAEEL 28S ribosomal protein S24, mitochondrial OS=Caenorhabditis elegans GN=F33D4.8 PE=3 SV=1 Back     alignment and function description
>sp|Q804H7|BI52B_XENLA Baculoviral IAP repeat-containing protein 5.2-B OS=Xenopus laevis GN=birc5.2-b PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query242
328701599159 PREDICTED: 28S ribosomal protein S24, mi 0.471 0.716 0.710 2e-46
239789197159 ACYPI005913 [Acyrthosiphon pisum] 0.471 0.716 0.703 6e-46
195453282165 GK12989 [Drosophila willistoni] gi|19416 0.524 0.769 0.584 2e-40
322789790156 hypothetical protein SINV_12944 [Solenop 0.491 0.762 0.609 5e-40
332374984165 unknown [Dendroctonus ponderosae] 0.533 0.781 0.583 2e-39
195037038165 GH19088 [Drosophila grimshawi] gi|193894 0.533 0.781 0.555 2e-38
194909901165 GG12367 [Drosophila erecta] gi|190656670 0.533 0.781 0.555 2e-38
194746456165 GF18891 [Drosophila ananassae] gi|190628 0.533 0.781 0.562 3e-38
17986187165 mitochondrial ribosomal protein S24 [Dro 0.533 0.781 0.548 3e-38
195504906165 GE10822 [Drosophila yakuba] gi|194185381 0.533 0.781 0.548 4e-38
>gi|328701599|ref|XP_001943070.2| PREDICTED: 28S ribosomal protein S24, mitochondrial-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  191 bits (486), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 91/128 (71%), Positives = 103/128 (80%), Gaps = 14/128 (10%)

Query: 19  KHVQAARYKTSKKGDKPLTYEMSGPPHTIAHIKSWNSWNTCNMLDGLRPSETAVEDEFI- 77
           KHVQAARYK S KG+KPLTYEM+GPPHTIAHIK WNSWNTCNMLDGLRP+ETA++DEFI 
Sbjct: 24  KHVQAARYKRSIKGNKPLTYEMAGPPHTIAHIKGWNSWNTCNMLDGLRPAETAIDDEFIR 83

Query: 78  -------------QIIIKRQHNIIRIGGIVERAIHPRKIYFLIGYTEELLSFWLQCPVKL 124
                        +IIIKRQHNIIRI  I  + I   K+YFLIGYTEELLS+WLQCP+KL
Sbjct: 84  RFMTGTWHDLIASEIIIKRQHNIIRIAAITVQKISVTKVYFLIGYTEELLSYWLQCPIKL 143

Query: 125 ELQTVENK 132
           ELQTVE++
Sbjct: 144 ELQTVEDR 151

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|239789197|dbj|BAH71238.1| ACYPI005913 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|195453282|ref|XP_002073719.1| GK12989 [Drosophila willistoni] gi|194169804|gb|EDW84705.1| GK12989 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|322789790|gb|EFZ14954.1| hypothetical protein SINV_12944 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|332374984|gb|AEE62633.1| unknown [Dendroctonus ponderosae] Back     alignment and taxonomy information
>gi|195037038|ref|XP_001989972.1| GH19088 [Drosophila grimshawi] gi|193894168|gb|EDV93034.1| GH19088 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|194909901|ref|XP_001982032.1| GG12367 [Drosophila erecta] gi|190656670|gb|EDV53902.1| GG12367 [Drosophila erecta] Back     alignment and taxonomy information
>gi|194746456|ref|XP_001955696.1| GF18891 [Drosophila ananassae] gi|190628733|gb|EDV44257.1| GF18891 [Drosophila ananassae] Back     alignment and taxonomy information
>gi|17986187|ref|NP_524476.1| mitochondrial ribosomal protein S24 [Drosophila melanogaster] gi|74868306|sp|Q9VCC3.1|RT24_DROME RecName: Full=28S ribosomal protein S24, mitochondrial; Short=MRP-S24; Short=S24mt; Flags: Precursor gi|7301114|gb|AAF56248.1| mitochondrial ribosomal protein S24 [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|195504906|ref|XP_002099280.1| GE10822 [Drosophila yakuba] gi|194185381|gb|EDW98992.1| GE10822 [Drosophila yakuba] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query242
FB|FBgn0039159165 mRpS24 "mitochondrial ribosoma 0.533 0.781 0.472 1.6e-29
UNIPROTKB|Q3B8K3170 mrps24-b "28S ribosomal protei 0.524 0.747 0.448 1.4e-18
UNIPROTKB|Q6NTS3170 mrps24-a "28S ribosomal protei 0.524 0.747 0.448 1.4e-18
UNIPROTKB|Q96EL2167 MRPS24 "28S ribosomal protein 0.5 0.724 0.410 1.8e-16
UNIPROTKB|E1BTU8173 LOC768589 "Uncharacterized pro 0.371 0.520 0.458 2e-15
UNIPROTKB|F1ST79167 MRPS24 "Uncharacterized protei 0.5 0.724 0.402 2e-15
ZFIN|ZDB-GENE-050522-393163 mrps24 "mitochondrial ribosoma 0.504 0.748 0.376 2e-15
UNIPROTKB|Q804H7157 birc5.2-b "Baculoviral IAP rep 0.351 0.541 0.430 3.3e-15
ZFIN|ZDB-GENE-030826-1190 birc5a "baculoviral IAP repeat 0.305 0.389 0.472 6.9e-15
UNIPROTKB|Q28ER3156 birc5.2 "Baculoviral IAP repea 0.318 0.493 0.454 8.8e-15
FB|FBgn0039159 mRpS24 "mitochondrial ribosomal protein S24" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 327 (120.2 bits), Expect = 1.6e-29, P = 1.6e-29
 Identities = 68/144 (47%), Positives = 88/144 (61%)

Query:     3 LKQVDIRGISTSATLLKHVQAARYKTSKKGDKPLTYEMSGPPHTIAHIKSWNSWNTCNML 62
             ++Q+   G  TS+   + VQ+ RY+ + K ++PLTYEM+ PPH I H KSWNSWNT  M 
Sbjct:    15 VQQLSRSGFHTSSVCCR-VQSGRYRITTKRNRPLTYEMANPPHFIGHRKSWNSWNTSTMK 73

Query:    63 DGLRPSETAVEDEFXXXXXXXX--------------XXXXXXGGIVERAIHPRKIYFLIG 108
             D LRPS+TA+ED F                              ++ +AI PRK+YFLIG
Sbjct:    74 DALRPSQTAIEDVFIRKFVTGTWHALVCSEVIIKRQHNTIRIAALIRQAITPRKMYFLIG 133

Query:   109 YTEELLSFWLQCPVKLELQTVENK 132
             YTEELLS+W+QCPV LELQTV +K
Sbjct:   134 YTEELLSYWMQCPVTLELQTVGDK 157
GO:0006412 "translation" evidence=ISS
GO:0005763 "mitochondrial small ribosomal subunit" evidence=ISS
GO:0003735 "structural constituent of ribosome" evidence=ISS
GO:0005762 "mitochondrial large ribosomal subunit" evidence=ISS
UNIPROTKB|Q3B8K3 mrps24-b "28S ribosomal protein S24-B, mitochondrial" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
UNIPROTKB|Q6NTS3 mrps24-a "28S ribosomal protein S24-A, mitochondrial" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
UNIPROTKB|Q96EL2 MRPS24 "28S ribosomal protein S24, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1BTU8 LOC768589 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1ST79 MRPS24 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050522-393 mrps24 "mitochondrial ribosomal protein S24" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q804H7 birc5.2-b "Baculoviral IAP repeat-containing protein 5.2-B" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030826-1 birc5a "baculoviral IAP repeat-containing 5a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q28ER3 birc5.2 "Baculoviral IAP repeat-containing protein 5.2" [Xenopus (Silurana) tropicalis (taxid:8364)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9VCC3RT24_DROMENo assigned EC number0.54860.53300.7818yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query242
smart0023871 smart00238, BIR, Baculoviral inhibition of apoptos 4e-20
cd0002269 cd00022, BIR, Baculoviral inhibition of apoptosis 2e-19
pfam0065369 pfam00653, BIR, Inhibitor of Apoptosis domain 4e-18
>gnl|CDD|197595 smart00238, BIR, Baculoviral inhibition of apoptosis protein repeat Back     alignment and domain information 
 Score = 80.8 bits (200), Expect = 4e-20
 Identities = 30/59 (50%), Positives = 37/59 (62%), Gaps = 3/59 (5%)

Query: 131 NKCTPENMATAGFYSISKLRNDTSVKCFCCLKELDGWESMDDPWEEHKRHQKDCPYIKL 189
           +KCTPE +A AGFY          VKCF C  ELD WE  DDPWEEHK+   +CP+++ 
Sbjct: 16  SKCTPEQLAEAGFYYTG---VGDEVKCFFCGGELDNWEPGDDPWEEHKKWSPNCPFVRN 71

Domain found in inhibitor of apoptosis proteins (IAPs) and other proteins. Acts as a direct inhibitor of caspase enzymes. Length = 71
>gnl|CDD|237989 cd00022, BIR, Baculoviral inhibition of apoptosis protein repeat domain; Found in inhibitors of apoptosis proteins (IAPs) and other proteins Back     alignment and domain information
>gnl|CDD|216045 pfam00653, BIR, Inhibitor of Apoptosis domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 242
PF14955136 MRP-S24: Mitochondrial ribosome subunit S24 100.0
KOG1101|consensus147 99.91
smart0023871 BIR Baculoviral inhibition of apoptosis protein re 99.86
PF0065370 BIR: Inhibitor of Apoptosis domain; InterPro: IPR0 99.86
cd0002269 BIR Baculoviral inhibition of apoptosis protein re 99.85
KOG1101|consensus147 99.12
smart0023871 BIR Baculoviral inhibition of apoptosis protein re 99.11
cd0002269 BIR Baculoviral inhibition of apoptosis protein re 99.09
PF0065370 BIR: Inhibitor of Apoptosis domain; InterPro: IPR0 99.05
PF07967133 zf-C3HC: C3HC zinc finger-like ; InterPro: IPR0129 93.69
PF11682128 DUF3279: Protein of unknown function (DUF3279); In 81.63
>PF14955 MRP-S24: Mitochondrial ribosome subunit S24 Back     alignment and domain information 
Probab=100.00  E-value=1.3e-36  Score=245.75  Aligned_cols=116  Identities=67%  Similarity=1.114  Sum_probs=112.3

Q ss_pred             hhhhcceeEeeccCCCccccccCCCCchhhhhhccccCcCccccCCCCCCccCCCceEE--------------EEEEecc
Q psy13053         19 KHVQAARYKTSKKGDKPLTYEMSGPPHTIAHIKSWNSWNTCNMLDGLRPSETAVEDEFI--------------QIIIKRQ   84 (242)
Q Consensus        19 ~~~~~~~~~~~~~~~~~ltye~a~~~~~i~RlkSF~~Wpt~na~aGF~y~~tg~~D~v~--------------~v~ikr~   84 (242)
                      .||||||||+|++|++|||||||++||+|+++|||+||||+|+++|...+++..+|+|+              +|+|||+
T Consensus         1 qk~~agr~r~t~~~~kplTYE~a~~Ph~Ig~rKsW~S~~T~nL~g~~~~~e~~~eD~fIRkFi~GTf~~~l~sEiiIKRr   80 (136)
T PF14955_consen    1 QKNRAGRYRVTPKGDKPLTYEMANPPHYIGHRKSWNSWHTSNLEGENRASERTVEDVFIRKFIRGTFPGLLASEIIIKRR   80 (136)
T ss_pred             CCcccceEEecCCCCCccchhhcCCCcEEeeeeeeccccccccccCCCCcchhhHHHHHHHhccCCCchhcchhhhhhhc
Confidence            38999999999999999999999999999999999999999999999999999999999              9999999


Q ss_pred             CCcccchhhhhhccCCCceeecccchHHhhhhhccCCcccccccccccCC
Q psy13053         85 HNIIRIGGIVERAIHPRKIYFLIGYTEELLSFWLQCPVKLELQTVENKCT  134 (242)
Q Consensus        85 gD~~~ia~~~Hrr~sP~C~y~ligytEerLstF~kwPvk~e~q~ve~k~t  134 (242)
                      +|.|+||++..++++|+.+|||+||+|++||.|++||+++++|+++++.+
T Consensus        81 ~N~I~Ia~~~~~~l~~~k~YFL~GYtEelLS~~lkcpVKlelqtv~~k~d  130 (136)
T PF14955_consen   81 HNVIRIAGIVLRRLQPRKIYFLIGYTEELLSHWLKCPVKLELQTVESKKD  130 (136)
T ss_pred             ccEEEEeEeeeccCCceeEEEehhhhHHHHHHHHCCCeEEEEEEcCCCCc
Confidence            99999999999999999999999999999999999999999999987654

>KOG1101|consensus Back     alignment and domain information
>smart00238 BIR Baculoviral inhibition of apoptosis protein repeat Back     alignment and domain information
>PF00653 BIR: Inhibitor of Apoptosis domain; InterPro: IPR001370 Peptide proteinase inhibitors can be found as single domain proteins or as single or multiple domains within proteins; these are referred to as either simple or compound inhibitors, respectively Back     alignment and domain information
>cd00022 BIR Baculoviral inhibition of apoptosis protein repeat domain; Found in inhibitors of apoptosis proteins (IAPs) and other proteins Back     alignment and domain information
>KOG1101|consensus Back     alignment and domain information
>smart00238 BIR Baculoviral inhibition of apoptosis protein repeat Back     alignment and domain information
>cd00022 BIR Baculoviral inhibition of apoptosis protein repeat domain; Found in inhibitors of apoptosis proteins (IAPs) and other proteins Back     alignment and domain information
>PF00653 BIR: Inhibitor of Apoptosis domain; InterPro: IPR001370 Peptide proteinase inhibitors can be found as single domain proteins or as single or multiple domains within proteins; these are referred to as either simple or compound inhibitors, respectively Back     alignment and domain information
>PF07967 zf-C3HC: C3HC zinc finger-like ; InterPro: IPR012935 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF11682 DUF3279: Protein of unknown function (DUF3279); InterPro: IPR021696 This family of proteins with unknown function appears to be restricted to Enterobacteriaceae Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query242
1f3h_A142 X-Ray Crystal Structure Of The Human Anti-Apoptotic 6e-13
2raw_A145 Crystal Structure Of The Borealin-survivin Complex 7e-13
3uig_A143 Crystal Structure Of Human Survivin In Complex With 7e-13
3uec_A146 Crystal Structure Of Human Survivin Bound To Histon 7e-13
1e31_A142 Survivin Dimer H. Sapiens Length = 142 7e-13
3uei_A146 Crystal Structure Of Human Survivin E65a Mutant Len 2e-12
2rax_A123 Crystal Structure Of Borealin (20-78) Bound To Surv 2e-12
1xox_A117 Solution Structure Of Human Survivin Length = 117 3e-12
3uee_A146 Crystal Structure Of Human Survivin K62a Mutant Bou 3e-12
3ueh_A146 Crystal Structure Of Human Survivin H80a Mutant Len 8e-12
1m4m_A140 Mouse Survivin Length = 140 2e-11
3uij_A143 Crystal Structure Of Human Survivin K62yH80W MUTANT 2e-10
3mup_A122 Ciap1-Bir3 Domain In Complex With The Smac-Mimetic 4e-08
4hy4_A115 Crystal Structure Of Ciap1 Bir3 Bound To T3170284 L 4e-08
2uvl_A96 Human Bir3 Domain Of Baculoviral Inhibitor Of Apopt 5e-08
3d9t_A97 Ciap1-Bir3 In Complex With N-Terminal Peptide From 6e-08
1qbh_A101 Solution Structure Of A Baculoviral Inhibitor Of Ap 6e-08
3t6p_A 345 Iap Antagonist-Induced Conformational Change In Cia 4e-07
3uw4_A92 Crystal Structure Of Ciap1 Bir3 Bound To Gdc0152 Le 6e-07
1i51_E117 Crystal Structure Of Caspase-7 Complexed With Xiap 6e-06
1i4o_C141 Crystal Structure Of The XiapCASPASE-7 Complex Leng 6e-06
1kmc_C119 Crystal Structure Of The Caspase-7 XIAP-Bir2 Comple 6e-06
1xb0_A108 Structure Of The Bir Domain Of Iap-Like Protein 2 L 2e-05
1i3o_E121 Crystal Structure Of The Complex Of Xiap-Bir2 And C 4e-05
1c9q_A117 Average Nmr Solution Structure Of The Bir-2 Domain 4e-05
2vsl_A96 Crystal Structure Of Xiap Bir3 With A Bivalent Smac 5e-05
3clx_D130 Crystal Structure Of Xiap Bir3 Domain In Complex Wi 5e-05
3hl5_A95 Crystal Structure Of Xiap Bir3 With Cs3 Length = 95 6e-05
1nw9_A98 Structure Of Caspase-9 In An Inhibitory Complex Wit 6e-05
2opy_A106 Smac Mimic Bound To Bir3-Xiap Length = 106 6e-05
2opz_A109 Avpf Bound To Bir3-Xiap Length = 109 6e-05
4hy0_A125 Crystal Structure Of Xiap Bir3 With T3256336 Length 7e-05
1f9x_A120 Average Nmr Solution Structure Of The Bir-3 Domain 7e-05
3eyl_A122 Crystal Structure Of Xiap Bir3 Domain In Complex Wi 7e-05
2jk7_A116 Xiap Bir3 Bound To A Smac Mimetic Length = 116 7e-05
1g3f_A117 Nmr Structure Of A 9 Residue Peptide From SmacDIABL 7e-05
1tw6_A133 Structure Of An Ml-IapXIAP CHIMERA BOUND TO A 9MER 8e-05
1g73_C121 Crystal Structure Of Smac Bound To Xiap-Bir3 Domain 8e-05
1oxn_A140 Structure And Function Analysis Of Peptide Antagoni 8e-05
2i3h_A133 Structure Of An Ml-iap/xiap Chimera Bound To A 4-me 8e-05
3uw5_A116 Crystal Structure Of The Bir Domain Of Mliap Bound 9e-05
3f7g_A140 Structure Of The Bir Domain From Ml-Iap Bound To A 9e-05
3m0a_D75 Crystal Structure Of Traf2:ciap2 Complex Length = 7 1e-04
3m1d_A85 Structure Of Bir1 From Ciap1 Length = 85 2e-04
>pdb|1F3H|A Chain A, X-Ray Crystal Structure Of The Human Anti-Apoptotic Protein Survivin Length = 142 Back     alignment and structure 
Iteration: 1

 Score = 70.9 bits (172), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 53/109 (48%)
Query: 133 CTPENMATAGFYSISKLRNDTSVKCFCCLKELDGWESMDDPWEEHKRHQKDCPYIKLNTV 192
           CTPE MA AGF            +CF C KEL+GWE  DDP EEHK+H   C ++ +   
Sbjct: 33  CTPERMAEAGFIHCPTENEPDMAQCFFCFKELEGWEPDDDPIEEHKKHSSGCAFLSVKKQ 92
Query: 193 EQQWTLEEWIDLQQAMAVKLLGTCAEVRSVEYCYQRNWHKRAVTSVIGL 241
            ++ TL E++ L +  A   +      +  E+       +RA+  +  +
Sbjct: 93  FEELTLGEFLKLDRERAKNKIAKETNNKKKEFEETAKKVRRAIEQLAAM 141
>pdb|2RAW|A Chain A, Crystal Structure Of The Borealin-survivin Complex Length = 145 Back     alignment and structure
>pdb|3UIG|A Chain A, Crystal Structure Of Human Survivin In Complex With T3 Phosphorylated H3(1-15) Peptide Length = 143 Back     alignment and structure
>pdb|3UEC|A Chain A, Crystal Structure Of Human Survivin Bound To Histone H3 Phosphorylated On Threonine-3. Length = 146 Back     alignment and structure
>pdb|1E31|A Chain A, Survivin Dimer H. Sapiens Length = 142 Back     alignment and structure
>pdb|3UEI|A Chain A, Crystal Structure Of Human Survivin E65a Mutant Length = 146 Back     alignment and structure
>pdb|2RAX|A Chain A, Crystal Structure Of Borealin (20-78) Bound To Survivin (1-120) Length = 123 Back     alignment and structure
>pdb|1XOX|A Chain A, Solution Structure Of Human Survivin Length = 117 Back     alignment and structure
>pdb|3UEE|A Chain A, Crystal Structure Of Human Survivin K62a Mutant Bound To N-Terminal Histone H3 Length = 146 Back     alignment and structure
>pdb|3UEH|A Chain A, Crystal Structure Of Human Survivin H80a Mutant Length = 146 Back     alignment and structure
>pdb|1M4M|A Chain A, Mouse Survivin Length = 140 Back     alignment and structure
>pdb|3UIJ|A Chain A, Crystal Structure Of Human Survivin K62yH80W MUTANT IN COMPLEX WITH SmacDIABLO(1-15) Peptide Length = 143 Back     alignment and structure
>pdb|3MUP|A Chain A, Ciap1-Bir3 Domain In Complex With The Smac-Mimetic Compound Smac037 Length = 122 Back     alignment and structure
>pdb|4HY4|A Chain A, Crystal Structure Of Ciap1 Bir3 Bound To T3170284 Length = 115 Back     alignment and structure
>pdb|2UVL|A Chain A, Human Bir3 Domain Of Baculoviral Inhibitor Of Apoptosis Repeat-Containing 3 (Birc3) Length = 96 Back     alignment and structure
>pdb|3D9T|A Chain A, Ciap1-Bir3 In Complex With N-Terminal Peptide From Caspase- 9 (Atpfqe) Length = 97 Back     alignment and structure
>pdb|1QBH|A Chain A, Solution Structure Of A Baculoviral Inhibitor Of Apoptosis (Iap) Repeat Length = 101 Back     alignment and structure
>pdb|3T6P|A Chain A, Iap Antagonist-Induced Conformational Change In Ciap1 Promotes E3 Ligase Activation Via Dimerization Length = 345 Back     alignment and structure
>pdb|3UW4|A Chain A, Crystal Structure Of Ciap1 Bir3 Bound To Gdc0152 Length = 92 Back     alignment and structure
>pdb|1I51|E Chain E, Crystal Structure Of Caspase-7 Complexed With Xiap Length = 117 Back     alignment and structure
>pdb|1I4O|C Chain C, Crystal Structure Of The XiapCASPASE-7 Complex Length = 141 Back     alignment and structure
>pdb|1KMC|C Chain C, Crystal Structure Of The Caspase-7 XIAP-Bir2 Complex Length = 119 Back     alignment and structure
>pdb|1XB0|A Chain A, Structure Of The Bir Domain Of Iap-Like Protein 2 Length = 108 Back     alignment and structure
>pdb|1I3O|E Chain E, Crystal Structure Of The Complex Of Xiap-Bir2 And Caspase 3 Length = 121 Back     alignment and structure
>pdb|1C9Q|A Chain A, Average Nmr Solution Structure Of The Bir-2 Domain Of Xiap Length = 117 Back     alignment and structure
>pdb|2VSL|A Chain A, Crystal Structure Of Xiap Bir3 With A Bivalent Smac Mimetic Length = 96 Back     alignment and structure
>pdb|3CLX|D Chain D, Crystal Structure Of Xiap Bir3 Domain In Complex With A Smac-Mimetic Compound, Smac005 Length = 130 Back     alignment and structure
>pdb|3HL5|A Chain A, Crystal Structure Of Xiap Bir3 With Cs3 Length = 95 Back     alignment and structure
>pdb|1NW9|A Chain A, Structure Of Caspase-9 In An Inhibitory Complex With Xiap- Bir3 Length = 98 Back     alignment and structure
>pdb|2OPY|A Chain A, Smac Mimic Bound To Bir3-Xiap Length = 106 Back     alignment and structure
>pdb|2OPZ|A Chain A, Avpf Bound To Bir3-Xiap Length = 109 Back     alignment and structure
>pdb|4HY0|A Chain A, Crystal Structure Of Xiap Bir3 With T3256336 Length = 125 Back     alignment and structure
>pdb|1F9X|A Chain A, Average Nmr Solution Structure Of The Bir-3 Domain Of Xiap Length = 120 Back     alignment and structure
>pdb|3EYL|A Chain A, Crystal Structure Of Xiap Bir3 Domain In Complex With A Smac-Mimetic Compound Length = 122 Back     alignment and structure
>pdb|2JK7|A Chain A, Xiap Bir3 Bound To A Smac Mimetic Length = 116 Back     alignment and structure
>pdb|1G3F|A Chain A, Nmr Structure Of A 9 Residue Peptide From SmacDIABLO Complexed To The Bir3 Domain Of Xiap Length = 117 Back     alignment and structure
>pdb|1TW6|A Chain A, Structure Of An Ml-IapXIAP CHIMERA BOUND TO A 9MER PEPTIDE DERIVED From Smac Length = 133 Back     alignment and structure
>pdb|1G73|C Chain C, Crystal Structure Of Smac Bound To Xiap-Bir3 Domain Length = 121 Back     alignment and structure
>pdb|1OXN|A Chain A, Structure And Function Analysis Of Peptide Antagonists Of Melanoma Inhibitor Of Apoptosis (Ml-Iap) Length = 140 Back     alignment and structure
>pdb|2I3H|A Chain A, Structure Of An Ml-iap/xiap Chimera Bound To A 4-mer Peptide (avpw) Length = 133 Back     alignment and structure
>pdb|3UW5|A Chain A, Crystal Structure Of The Bir Domain Of Mliap Bound To Gdc0152 Length = 116 Back     alignment and structure
>pdb|3F7G|A Chain A, Structure Of The Bir Domain From Ml-Iap Bound To A Peptidomimetic Length = 140 Back     alignment and structure
>pdb|3M0A|D Chain D, Crystal Structure Of Traf2:ciap2 Complex Length = 75 Back     alignment and structure
>pdb|3M1D|A Chain A, Structure Of Bir1 From Ciap1 Length = 85 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query242
2qfa_A142 Baculoviral IAP repeat-containing protein 5; three 2e-23
1i4o_C141 X-linked IAP, baculoviral IAP repeat-containing pr 4e-21
2vm5_A106 Baculoviral IAP repeat-containing protein 1; apopt 3e-20
3d9t_A97 Baculoviral IAP repeat-containing protein 2; zinc 4e-20
3hl5_A95 Baculoviral IAP repeat-containing protein 4; BIR, 5e-20
1jd5_A124 DIAP1, apoptosis 1 inhibitor; IAP, caspase activat 6e-20
3m1d_A85 Baculoviral IAP repeat-containing protein 2; BIR, 8e-20
3mup_A122 Baculoviral IAP repeat-containing protein 2; zinc- 1e-19
1se0_A116 Apoptosis 1 inhibitor; apoptosis, IAP, BIR, caspas 2e-19
3siq_A136 Apoptosis 1 inhibitor; DIAP1-BIR1 domain, ligase; 3e-19
2poi_A94 Baculoviral IAP repeat-containing protein 4; zinc 3e-19
2qra_D111 XIAP, baculoviral IAP repeat-containing protein 4, 7e-19
1g73_C121 Inhibitors of apoptosis-like protein ILP; helix bu 1e-18
2i3h_A133 Baculoviral IAP repeat-containing protein 7; zinc 3e-17
3t6p_A 345 Baculoviral IAP repeat-containing protein 2; ring, 2e-14
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-06
>2qfa_A Baculoviral IAP repeat-containing protein 5; three-helical-bundle, long helix, protein complex, alternative splicing, apoptosis, cell cycle, cell division; HET: MES; 1.40A {Homo sapiens} SCOP: g.52.1.1 PDB: 1e31_A* 4a0i_A 4a0j_A* 4a0n_A* 2raw_A 3uec_A* 3ued_A* 3uef_A 3uig_A* 3uih_A 3uii_A 1f3h_A 3uee_A 3ueg_A* 3uei_A 3ueh_A* 3uik_A 3uij_A 1m4m_A 2rax_A ... Length = 142 Back     alignment and structure
 Score = 91.3 bits (226), Expect = 2e-23
 Identities = 32/82 (39%), Positives = 44/82 (53%)

Query: 132 KCTPENMATAGFYSISKLRNDTSVKCFCCLKELDGWESMDDPWEEHKRHQKDCPYIKLNT 191
            CTPE MA AGF            +CF C KEL+GWE  DDP EEHK+H   C ++ +  
Sbjct: 32  ACTPERMAEAGFIHCPTENEPDLAQCFFCFKELEGWEPDDDPIEEHKKHSSGCAFLSVKK 91

Query: 192 VEQQWTLEEWIDLQQAMAVKLL 213
             ++ TL E++ L +  A   +
Sbjct: 92  QFEELTLGEFLKLDRERAKNKI 113
>1i4o_C X-linked IAP, baculoviral IAP repeat-containing protein 4; protease-inhibitor, apoptosis-hydrolase complex; 2.40A {Homo sapiens} PDB: 1kmc_C 1i51_E 1i3o_E 1c9q_A Length = 141 Back     alignment and structure
>2vm5_A Baculoviral IAP repeat-containing protein 1; apoptosis; 1.80A {Homo sapiens} Length = 106 Back     alignment and structure
>3d9t_A Baculoviral IAP repeat-containing protein 2; zinc finger, apoptosis, cytoplasm, metal-binding, polymorphism, zinc, zinc-finger, alternative splicing, hydrolase, protease; 1.50A {Homo sapiens} SCOP: g.52.1.1 PDB: 3d9u_A 3uw4_A* 2uvl_A Length = 97 Back     alignment and structure
>3hl5_A Baculoviral IAP repeat-containing protein 4; BIR, apoptosis, small molecule drug discovery, structur drug design, ligase, metal-binding; HET: 9JZ; 1.80A {Homo sapiens} PDB: 1nw9_A 2vsl_A Length = 95 Back     alignment and structure
>1jd5_A DIAP1, apoptosis 1 inhibitor; IAP, caspase activation; 1.90A {Drosophila melanogaster} SCOP: g.52.1.1 PDB: 1jd4_A 1jd6_A 1q4q_A Length = 124 Back     alignment and structure
>3m1d_A Baculoviral IAP repeat-containing protein 2; BIR, apoptosis, cytoplasm, polymorphism, zinc, zinc-FIN metal binding protein; 2.00A {Homo sapiens} PDB: 3m0a_D 3m0d_D Length = 85 Back     alignment and structure
>3mup_A Baculoviral IAP repeat-containing protein 2; zinc-finger motif, apoptosis inhibitor; HET: SMK; 2.60A {Homo sapiens} PDB: 3oz1_A* Length = 122 Back     alignment and structure
>1se0_A Apoptosis 1 inhibitor; apoptosis, IAP, BIR, caspase; 1.75A {Drosophila melanogaster} SCOP: g.52.1.1 PDB: 1sdz_A 3sip_E Length = 116 Back     alignment and structure
>3siq_A Apoptosis 1 inhibitor; DIAP1-BIR1 domain, ligase; 2.40A {Drosophila melanogaster} Length = 136 Back     alignment and structure
>2poi_A Baculoviral IAP repeat-containing protein 4; zinc finger, signaling protein/apoptosis complex; 1.80A {Homo sapiens} PDB: 2pop_B Length = 94 Back     alignment and structure
>2qra_D XIAP, baculoviral IAP repeat-containing protein 4, inhibitor; apoptosis, signaling protein, zinc binding; 2.50A {Homo sapiens} Length = 111 Back     alignment and structure
>1g73_C Inhibitors of apoptosis-like protein ILP; helix bundle, zinc-binding domain, apoptosis/apoptosis inhibitor complex; 2.00A {Homo sapiens} SCOP: g.52.1.1 PDB: 3cm2_D* 3clx_D* 3cm7_C* 1f9x_A 1g3f_A 1tfq_A* 1tft_A* 3eyl_A* 3g76_A* 2jk7_A* 2opz_A 2opy_A* 1xb0_A 1xb1_A Length = 121 Back     alignment and structure
>2i3h_A Baculoviral IAP repeat-containing protein 7; zinc binding, peptide complex, apoptosis inhibition, peptidomimetic, small molecule, drug design, inhibitor/apoptosis complex; HET: BTB; 1.62A {Homo sapiens} SCOP: g.52.1.1 PDB: 2i3i_A* 3f7h_A* 3f7i_A* 3gt9_A* 3gta_A* 1tw6_A* 3uw5_A* 3f7g_A* 1oxn_A* 1oxq_A* 1oy7_A* Length = 133 Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A Length = 345 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query242
2qfa_A142 Baculoviral IAP repeat-containing protein 5; three 99.96
2vm5_A106 Baculoviral IAP repeat-containing protein 1; apopt 99.93
2poi_A94 Baculoviral IAP repeat-containing protein 4; zinc 99.93
3mup_A122 Baculoviral IAP repeat-containing protein 2; zinc- 99.93
2i3h_A133 Baculoviral IAP repeat-containing protein 7; zinc 99.92
1jd5_A124 DIAP1, apoptosis 1 inhibitor; IAP, caspase activat 99.92
3hl5_A95 Baculoviral IAP repeat-containing protein 4; BIR, 99.92
3d9t_A97 Baculoviral IAP repeat-containing protein 2; zinc 99.92
3m1d_A85 Baculoviral IAP repeat-containing protein 2; BIR, 99.92
2qra_D111 XIAP, baculoviral IAP repeat-containing protein 4, 99.92
1se0_A116 Apoptosis 1 inhibitor; apoptosis, IAP, BIR, caspas 99.92
1i4o_C141 X-linked IAP, baculoviral IAP repeat-containing pr 99.92
3siq_A136 Apoptosis 1 inhibitor; DIAP1-BIR1 domain, ligase; 99.92
1g73_C121 Inhibitors of apoptosis-like protein ILP; helix bu 99.91
3t6p_A 345 Baculoviral IAP repeat-containing protein 2; ring, 99.87
2qfa_A142 Baculoviral IAP repeat-containing protein 5; three 99.42
2poi_A94 Baculoviral IAP repeat-containing protein 4; zinc 99.42
3m1d_A85 Baculoviral IAP repeat-containing protein 2; BIR, 99.4
2vm5_A106 Baculoviral IAP repeat-containing protein 1; apopt 99.4
2qra_D111 XIAP, baculoviral IAP repeat-containing protein 4, 99.37
3siq_A136 Apoptosis 1 inhibitor; DIAP1-BIR1 domain, ligase; 99.33
1se0_A116 Apoptosis 1 inhibitor; apoptosis, IAP, BIR, caspas 99.32
3d9t_A97 Baculoviral IAP repeat-containing protein 2; zinc 99.32
2i3h_A133 Baculoviral IAP repeat-containing protein 7; zinc 99.3
1i4o_C141 X-linked IAP, baculoviral IAP repeat-containing pr 99.29
1jd5_A124 DIAP1, apoptosis 1 inhibitor; IAP, caspase activat 99.29
3hl5_A95 Baculoviral IAP repeat-containing protein 4; BIR, 99.26
3mup_A122 Baculoviral IAP repeat-containing protein 2; zinc- 99.25
1g73_C121 Inhibitors of apoptosis-like protein ILP; helix bu 99.24
3t6p_A 345 Baculoviral IAP repeat-containing protein 2; ring, 99.02
>2qfa_A Baculoviral IAP repeat-containing protein 5; three-helical-bundle, long helix, protein complex, alternative splicing, apoptosis, cell cycle, cell division; HET: MES; 1.40A {Homo sapiens} SCOP: g.52.1.1 PDB: 1e31_A* 4a0i_A 4a0j_A* 4a0n_A* 2raw_A 3uec_A* 3ued_A* 3uef_A 3uig_A* 3uih_A 3uii_A 1f3h_A 3uee_A 3ueg_A* 3uei_A 3ueh_A* 3uik_A 3uij_A 1m4m_A 2rax_A ... Back     alignment and structure
Probab=99.96  E-value=1.7e-29  Score=207.45  Aligned_cols=111  Identities=32%  Similarity=0.576  Sum_probs=95.1

Q ss_pred             ccchHHhhhhhccCCcccccccccccCChhhhhhcCceecCCCCCCCcEEEeecCCccCCccCCCCcHHHHhccCCCCcc
Q psy13053        107 IGYTEELLSFWLQCPVKLELQTVENKCTPENMATAGFYSISKLRNDTSVKCFCCLKELDGWESMDDPWEEHKRHQKDCPY  186 (242)
Q Consensus       107 igytEerLstF~kwPvk~e~q~ve~k~t~~~LA~AGFyytg~~~~~D~v~Cf~C~~~l~~We~~DdP~~EH~r~sp~C~f  186 (242)
                      +...+.||.||.+||....     .+++|++||+|||||+|+...+|.|+||+|+++|.+|+++||||+||++|+|+|+|
T Consensus        12 ~~~~~~Rl~TF~~WP~~~~-----~~~~p~~LA~AGFyy~g~~~~~D~V~Cf~C~~~L~~We~~DdP~~EH~r~~p~C~F   86 (142)
T 2qfa_A           12 PFLKDHRISTFKNWPFLEG-----CACTPERMAEAGFIHCPTENEPDLAQCFFCFKELEGWEPDDDPIEEHKKHSSGCAF   86 (142)
T ss_dssp             GGSHHHHHHTCCSCSCCSS-----CSSCHHHHHHTTEEECCBTTBTTCEEETTTCCEECCCCTTCCHHHHHHHHCTTCGG
T ss_pred             ccCHHHHHHHHhcCCccCC-----cCCCHHHHHHcCCCcCCCCCCCCEEEcCCCCCEecccCCCCCHHHHHHHHCcCCcc
Confidence            4456889999999998631     24689999999999999555569999999999999999999999999999999999


Q ss_pred             cccccccccccHHHHHHHHHHHH----HHhhhhhhhhhhhhH
Q psy13053        187 IKLNTVEQQWTLEEWIDLQQAMA----VKLLGTCAEVRSVEY  224 (242)
Q Consensus       187 v~~~k~~~~~~~~~~~~l~~~~~----~~~~~~~~~~~~~~~  224 (242)
                      ++..|+++++|+++|++|.+.+.    .++.  ++++.+|+.
T Consensus        87 ~~~~k~~~~~t~~~~l~l~~~~~~~~~~~~~--~~r~~~F~~  126 (142)
T 2qfa_A           87 LSVKKQFEELTLGEFLKLDRERAKNKIAKET--NNKKKEFEE  126 (142)
T ss_dssp             GGCCSCGGGCBHHHHHHHHHHHHHHHHHHHH--HHHHHHHHH
T ss_pred             eecccccchhhHHHHhhhhhHHHHHHHHHHH--HHHHHHHHH
Confidence            99999999999999999976543    3333  777888865
>2vm5_A Baculoviral IAP repeat-containing protein 1; apoptosis; 1.80A {Homo sapiens} Back     alignment and structure
>2poi_A Baculoviral IAP repeat-containing protein 4; zinc finger, signaling protein/apoptosis complex; 1.80A {Homo sapiens} PDB: 2pop_B Back     alignment and structure
>3mup_A Baculoviral IAP repeat-containing protein 2; zinc-finger motif, apoptosis inhibitor; HET: SMK; 2.60A {Homo sapiens} SCOP: g.52.1.1 PDB: 3oz1_A* 4eb9_A* Back     alignment and structure
>2i3h_A Baculoviral IAP repeat-containing protein 7; zinc binding, peptide complex, apoptosis inhibition, peptidomimetic, small molecule, drug design, inhibitor/apoptosis complex; HET: BTB; 1.62A {Homo sapiens} SCOP: g.52.1.1 PDB: 2i3i_A* 3f7h_A* 3f7i_A* 3gt9_A* 3gta_A* 1tw6_A* 3uw5_A* 3f7g_A* 1oxn_A* 1oxq_A* 1oy7_A* Back     alignment and structure
>1jd5_A DIAP1, apoptosis 1 inhibitor; IAP, caspase activation; 1.90A {Drosophila melanogaster} SCOP: g.52.1.1 PDB: 1jd4_A 1jd6_A 1q4q_A Back     alignment and structure
>3hl5_A Baculoviral IAP repeat-containing protein 4; BIR, apoptosis, small molecule drug discovery, structur drug design, ligase, metal-binding; HET: 9JZ; 1.80A {Homo sapiens} PDB: 1nw9_A 2vsl_A Back     alignment and structure
>3d9t_A Baculoviral IAP repeat-containing protein 2; zinc finger, apoptosis, cytoplasm, metal-binding, polymorphism, zinc, zinc-finger, alternative splicing, hydrolase, protease; 1.50A {Homo sapiens} SCOP: g.52.1.1 PDB: 3d9u_A 3uw4_A* 2uvl_A Back     alignment and structure
>3m1d_A Baculoviral IAP repeat-containing protein 2; BIR, apoptosis, cytoplasm, polymorphism, zinc, zinc-FIN metal binding protein; 2.00A {Homo sapiens} PDB: 3m0a_D 3m0d_D Back     alignment and structure
>2qra_D XIAP, baculoviral IAP repeat-containing protein 4, inhibitor; apoptosis, signaling protein, zinc binding; 2.50A {Homo sapiens} Back     alignment and structure
>1se0_A Apoptosis 1 inhibitor; apoptosis, IAP, BIR, caspase; 1.75A {Drosophila melanogaster} SCOP: g.52.1.1 PDB: 1sdz_A 3sip_E Back     alignment and structure
>1i4o_C X-linked IAP, baculoviral IAP repeat-containing protein 4; protease-inhibitor, apoptosis-hydrolase complex; 2.40A {Homo sapiens} PDB: 1kmc_C 1i51_E 1i3o_E 1c9q_A Back     alignment and structure
>3siq_A Apoptosis 1 inhibitor; DIAP1-BIR1 domain, ligase; 2.40A {Drosophila melanogaster} Back     alignment and structure
>1g73_C Inhibitors of apoptosis-like protein ILP; helix bundle, zinc-binding domain, apoptosis/apoptosis inhibitor complex; 2.00A {Homo sapiens} SCOP: g.52.1.1 PDB: 3cm2_D* 3clx_D* 3cm7_C* 1f9x_A 1g3f_A 1tfq_A* 1tft_A* 3eyl_A* 3g76_A* 2jk7_A* 2opz_A 2opy_A* 1xb0_A 1xb1_A Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>2qfa_A Baculoviral IAP repeat-containing protein 5; three-helical-bundle, long helix, protein complex, alternative splicing, apoptosis, cell cycle, cell division; HET: MES; 1.40A {Homo sapiens} SCOP: g.52.1.1 PDB: 1e31_A* 4a0i_A 4a0j_A* 4a0n_A* 2raw_A 3uec_A* 3ued_A* 3uef_A 3uig_A* 3uih_A 3uii_A 1f3h_A 3uee_A 3ueg_A* 3uei_A 3ueh_A* 3uik_A 3uij_A 1m4m_A 2rax_A ... Back     alignment and structure
>2poi_A Baculoviral IAP repeat-containing protein 4; zinc finger, signaling protein/apoptosis complex; 1.80A {Homo sapiens} PDB: 2pop_B Back     alignment and structure
>3m1d_A Baculoviral IAP repeat-containing protein 2; BIR, apoptosis, cytoplasm, polymorphism, zinc, zinc-FIN metal binding protein; 2.00A {Homo sapiens} PDB: 3m0a_D 3m0d_D Back     alignment and structure
>2vm5_A Baculoviral IAP repeat-containing protein 1; apoptosis; 1.80A {Homo sapiens} Back     alignment and structure
>2qra_D XIAP, baculoviral IAP repeat-containing protein 4, inhibitor; apoptosis, signaling protein, zinc binding; 2.50A {Homo sapiens} Back     alignment and structure
>3siq_A Apoptosis 1 inhibitor; DIAP1-BIR1 domain, ligase; 2.40A {Drosophila melanogaster} Back     alignment and structure
>1se0_A Apoptosis 1 inhibitor; apoptosis, IAP, BIR, caspase; 1.75A {Drosophila melanogaster} SCOP: g.52.1.1 PDB: 1sdz_A 3sip_E Back     alignment and structure
>3d9t_A Baculoviral IAP repeat-containing protein 2; zinc finger, apoptosis, cytoplasm, metal-binding, polymorphism, zinc, zinc-finger, alternative splicing, hydrolase, protease; 1.50A {Homo sapiens} SCOP: g.52.1.1 PDB: 3d9u_A 3uw4_A* 2uvl_A Back     alignment and structure
>2i3h_A Baculoviral IAP repeat-containing protein 7; zinc binding, peptide complex, apoptosis inhibition, peptidomimetic, small molecule, drug design, inhibitor/apoptosis complex; HET: BTB; 1.62A {Homo sapiens} SCOP: g.52.1.1 PDB: 2i3i_A* 3f7h_A* 3f7i_A* 3gt9_A* 3gta_A* 1tw6_A* 3uw5_A* 3f7g_A* 1oxn_A* 1oxq_A* 1oy7_A* Back     alignment and structure
>1i4o_C X-linked IAP, baculoviral IAP repeat-containing protein 4; protease-inhibitor, apoptosis-hydrolase complex; 2.40A {Homo sapiens} PDB: 1kmc_C 1i51_E 1i3o_E 1c9q_A Back     alignment and structure
>1jd5_A DIAP1, apoptosis 1 inhibitor; IAP, caspase activation; 1.90A {Drosophila melanogaster} SCOP: g.52.1.1 PDB: 1jd4_A 1jd6_A 1q4q_A Back     alignment and structure
>3hl5_A Baculoviral IAP repeat-containing protein 4; BIR, apoptosis, small molecule drug discovery, structur drug design, ligase, metal-binding; HET: 9JZ; 1.80A {Homo sapiens} PDB: 1nw9_A 2vsl_A Back     alignment and structure
>3mup_A Baculoviral IAP repeat-containing protein 2; zinc-finger motif, apoptosis inhibitor; HET: SMK; 2.60A {Homo sapiens} SCOP: g.52.1.1 PDB: 3oz1_A* 4eb9_A* Back     alignment and structure
>1g73_C Inhibitors of apoptosis-like protein ILP; helix bundle, zinc-binding domain, apoptosis/apoptosis inhibitor complex; 2.00A {Homo sapiens} SCOP: g.52.1.1 PDB: 3cm2_D* 3clx_D* 3cm7_C* 1f9x_A 1g3f_A 1tfq_A* 1tft_A* 3eyl_A* 3g76_A* 2jk7_A* 2opz_A 2opy_A* 1xb0_A 1xb1_A Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 242
d2qfaa1137 g.52.1.1 (A:5-141) Anti-apoptotic protein survivin 2e-23
d1se0a_97 g.52.1.1 (A:) BIR domains of DIAP1 {Fruit fly (Dro 4e-20
d2i3ha190 g.52.1.1 (A:78-167) BIR-containing protein 7 (ML-I 4e-20
d2vsla196 g.52.1.1 (A:250-345) BIR domains of XIAP {Human (H 5e-20
d1jd5a_105 g.52.1.1 (A:) BIR domains of DIAP1 {Fruit fly (Dro 1e-19
d1i3oe_111 g.52.1.1 (E:) BIR domains of XIAP {Human (Homo sap 1e-19
d3d9ta187 g.52.1.1 (A:260-346) 2MIHB/C-IAP-1 {Human (Homo sa 2e-18
>d2qfaa1 g.52.1.1 (A:5-141) Anti-apoptotic protein survivin {Human (Homo sapiens) [TaxId: 9606]} Length = 137 Back     information, alignment and structure

class: Small proteins
fold: Inhibitor of apoptosis (IAP) repeat
superfamily: Inhibitor of apoptosis (IAP) repeat
family: Inhibitor of apoptosis (IAP) repeat
domain: Anti-apoptotic protein survivin
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 89.7 bits (222), Expect = 2e-23
 Identities = 31/75 (41%), Positives = 42/75 (56%)

Query: 132 KCTPENMATAGFYSISKLRNDTSVKCFCCLKELDGWESMDDPWEEHKRHQKDCPYIKLNT 191
            CTPE MA AGF            +CF C KEL+GWE  DDP EEHK+H   C ++ +  
Sbjct: 28  ACTPERMAEAGFIHCPTENEPDLAQCFFCFKELEGWEPDDDPIEEHKKHSSGCAFLSVKK 87

Query: 192 VEQQWTLEEWIDLQQ 206
             ++ TL E++ L +
Sbjct: 88  QFEELTLGEFLKLDR 102
>d1se0a_ g.52.1.1 (A:) BIR domains of DIAP1 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 97 Back     information, alignment and structure
>d2i3ha1 g.52.1.1 (A:78-167) BIR-containing protein 7 (ML-IAP, livin) {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2vsla1 g.52.1.1 (A:250-345) BIR domains of XIAP {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1jd5a_ g.52.1.1 (A:) BIR domains of DIAP1 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 105 Back     information, alignment and structure
>d1i3oe_ g.52.1.1 (E:) BIR domains of XIAP {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d3d9ta1 g.52.1.1 (A:260-346) 2MIHB/C-IAP-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 87 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query242
d2qfaa1137 Anti-apoptotic protein survivin {Human (Homo sapie 99.95
d3d9ta187 2MIHB/C-IAP-1 {Human (Homo sapiens) [TaxId: 9606]} 99.93
d2i3ha190 BIR-containing protein 7 (ML-IAP, livin) {Human (H 99.93
d1jd5a_105 BIR domains of DIAP1 {Fruit fly (Drosophila melano 99.92
d2vsla196 BIR domains of XIAP {Human (Homo sapiens) [TaxId: 99.92
d1se0a_97 BIR domains of DIAP1 {Fruit fly (Drosophila melano 99.92
d1i3oe_111 BIR domains of XIAP {Human (Homo sapiens) [TaxId: 99.91
d3d9ta187 2MIHB/C-IAP-1 {Human (Homo sapiens) [TaxId: 9606]} 99.44
d2i3ha190 BIR-containing protein 7 (ML-IAP, livin) {Human (H 99.42
d1se0a_97 BIR domains of DIAP1 {Fruit fly (Drosophila melano 99.41
d1i3oe_111 BIR domains of XIAP {Human (Homo sapiens) [TaxId: 99.35
d2vsla196 BIR domains of XIAP {Human (Homo sapiens) [TaxId: 99.33
d1jd5a_105 BIR domains of DIAP1 {Fruit fly (Drosophila melano 99.31
d2qfaa1137 Anti-apoptotic protein survivin {Human (Homo sapie 99.16
>d2qfaa1 g.52.1.1 (A:5-141) Anti-apoptotic protein survivin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: Inhibitor of apoptosis (IAP) repeat
superfamily: Inhibitor of apoptosis (IAP) repeat
family: Inhibitor of apoptosis (IAP) repeat
domain: Anti-apoptotic protein survivin
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.95  E-value=5.9e-29  Score=201.25  Aligned_cols=100  Identities=34%  Similarity=0.663  Sum_probs=88.7

Q ss_pred             chHHhhhhhccCCcccccccccccCChhhhhhcCceecCCCCCCCcEEEeecCCccCCccCCCCcHHHHhccCCCCcccc
Q psy13053        109 YTEELLSFWLQCPVKLELQTVENKCTPENMATAGFYSISKLRNDTSVKCFCCLKELDGWESMDDPWEEHKRHQKDCPYIK  188 (242)
Q Consensus       109 ytEerLstF~kwPvk~e~q~ve~k~t~~~LA~AGFyytg~~~~~D~v~Cf~C~~~l~~We~~DdP~~EH~r~sp~C~fv~  188 (242)
                      ..+.||.||.+||....     ..++|++||+|||||+|+.+.+|.|+||+|+++|.+|+++||||+||++++|+|+||+
T Consensus        10 ~~~~Rl~TF~~WP~~~~-----~~~~~~~LA~AGFyy~~~~~~~D~v~Cf~C~~~l~~We~~DdP~~eH~~~~p~C~fv~   84 (137)
T d2qfaa1          10 LKDHRISTFKNWPFLEG-----CACTPERMAEAGFIHCPTENEPDLAQCFFCFKELEGWEPDDDPIEEHKKHSSGCAFLS   84 (137)
T ss_dssp             SHHHHHHTCCSCSCCSS-----CSSCHHHHHHTTEEECCBTTBTTCEEETTTCCEECCCCTTCCHHHHHHHHCTTCGGGG
T ss_pred             cHHHHHHHHhcCCCccC-----CCCCHHHHHhcCceECCCCCCCCeEEecccCCCcCCCCCCCCHHHHHHHHCcCCceEe
Confidence            45789999999996421     3679999999999998876689999999999999999999999999999999999999


Q ss_pred             cccccccccHHHHHHHHHHHHHHhh
Q psy13053        189 LNTVEQQWTLEEWIDLQQAMAVKLL  213 (242)
Q Consensus       189 ~~k~~~~~~~~~~~~l~~~~~~~~~  213 (242)
                      +.|++.++++.+++++.++.....+
T Consensus        85 ~~k~~~~~~~~e~l~~~~~~~~~~~  109 (137)
T d2qfaa1          85 VKKQFEELTLGEFLKLDRERAKNKI  109 (137)
T ss_dssp             CCSCGGGCBHHHHHHHHHHHHHHHH
T ss_pred             eeCCCccchHHHHHHhhhHHHHHHH
Confidence            9999999999999999876655433
>d3d9ta1 g.52.1.1 (A:260-346) 2MIHB/C-IAP-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i3ha1 g.52.1.1 (A:78-167) BIR-containing protein 7 (ML-IAP, livin) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jd5a_ g.52.1.1 (A:) BIR domains of DIAP1 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2vsla1 g.52.1.1 (A:250-345) BIR domains of XIAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1se0a_ g.52.1.1 (A:) BIR domains of DIAP1 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1i3oe_ g.52.1.1 (E:) BIR domains of XIAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3d9ta1 g.52.1.1 (A:260-346) 2MIHB/C-IAP-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i3ha1 g.52.1.1 (A:78-167) BIR-containing protein 7 (ML-IAP, livin) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1se0a_ g.52.1.1 (A:) BIR domains of DIAP1 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1i3oe_ g.52.1.1 (E:) BIR domains of XIAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vsla1 g.52.1.1 (A:250-345) BIR domains of XIAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jd5a_ g.52.1.1 (A:) BIR domains of DIAP1 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2qfaa1 g.52.1.1 (A:5-141) Anti-apoptotic protein survivin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure