Diaphorina citri psyllid: psy13063

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310------

CFIECFIVCFSHSYRGSGVSSPTNVSVYNTTLFRRISFGVCGRFTSAELFSFSLSLFIVCIWVLTGHWLLMDAMGMGLCVAFIAFVRLPSLKVSTLLLTGLLIYDVFWVFFSSYIFSTNVMVKVATRPAENPVGLVAKRFHMGGVARDAPKLSLPGKLVFPSLHQTGHFSMLRGLGDIVMPGLLLCFVLRYDAYKKSQLLHLGLGDIVMPGLLLCFVLRYDAYKKSQLLHLGETGIPAPRHLSRISYFHCSLIGYFLGLLTATVSSEIFKAAQPALLYLVPFTLLPLLTMAYLKGDLRRMWSEPFIIVPPSKHMDI

ccEEEEEEEEccccccccccccccCEECccEEEEEECccCEEECcHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcEEEEEEEccEEEEEEEEEEEccccccccccccccccccccccccccccccEEEEECccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccccccccccEEEEEEEHHHcccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccEEEECcHHHHHHHHHHHHHcHHHHccccccccccccccccc

CFIECFIVCFSHSYRGSGVSSPTNVSVYNTTLFRRISFGVCGRFTSAELFSFSLSLFIVCIWVLTGHWLLMDAMGMGLCVAFIAFVRLPSLKVSTLLLTGLLIYDVFWVFFSSYIFSTNVMVKVATRPAENPVGLVAKRFHMGGVARDAPKLSLPGKLVFPSLHQTGHFSMLRGLGDIVMPGLLLCFVLRYDAYKKSQLLHLGLGDIVMPGLLLCFVLRYDAYKKSQLLH*********RHLSRISYFHCSLIGYFLGLLTATVSSEIFKAAQPALLYLVPFTLLPLLTMAYLKGDLRRMWSEP************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHxxxxHHHHHxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Signal peptide peptidase-like 3	Intramembrane-cleaving aspartic protease (I-CLiP) that cleaves type II membrane signal peptides in the hydrophobic plane of the membrane.	confident	Q9CUS9
Signal peptide peptidase-like 3	Intramembrane-cleaving aspartic protease (I-CLiP) that cleaves type II membrane signal peptides in the hydrophobic plane of the membrane.	confident	Q8TCT6
Signal peptide peptidase-like 1	Intramembrane-cleaving aspartic protease (I-CLiP) that cleaves type II membrane signal peptides in the hydrophobic plane of the membrane.	confident	Q7G7C7

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0042500 [MF]	aspartic endopeptidase activity, intramembrane cleaving	probable	GO:0016787, GO:0004175, GO:0070001, GO:0003824, GO:0070011, GO:0004190, GO:0003674, GO:0008233
GO:0006465 [BP]	signal peptide processing	probable	GO:0044267, GO:0051604, GO:1901564, GO:0043603, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0034641, GO:0044237, GO:0043170, GO:0071704, GO:0010467, GO:0006807, GO:0008150, GO:0008152, GO:0016485, GO:0006518
GO:0005791 [CC]	rough endoplasmic reticulum	probable	GO:0005737, GO:0005783, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226, GO:0043231
GO:0071458 [CC]	integral to cytosolic side of endoplasmic reticulum membrane	probable	GO:0005783, GO:0005789, GO:0042175, GO:0043229, GO:0030176, GO:0031301, GO:0031300, GO:0043227, GO:0031227, GO:0031224, GO:0005737, GO:0044446, GO:0031090, GO:0016021, GO:0016020, GO:0043226, GO:0044432, GO:0012505, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0044425, GO:0044422
GO:0030660 [CC]	Golgi-associated vesicle membrane	probable	GO:0043229, GO:0005622, GO:0043227, GO:0043226, GO:0005737, GO:0005575, GO:0031982, GO:0016023, GO:0031410, GO:0016020, GO:0031988, GO:0044433, GO:0044431, GO:0005794, GO:0005798, GO:0030659, GO:0012505, GO:0012506, GO:0031090, GO:0043231, GO:0044464, GO:0005623, GO:0000139, GO:0044446, GO:0044444, GO:0044424, GO:0044422
GO:0006509 [BP]	membrane protein ectodomain proteolysis	probable	GO:0044238, GO:0019538, GO:0033619, GO:0043170, GO:0071704, GO:0008150, GO:0008152, GO:0006508
GO:0042803 [MF]	protein homodimerization activity	probable	GO:0046983, GO:0003674, GO:0005515, GO:0042802, GO:0005488
GO:0005768 [CC]	endosome	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0071556 [CC]	integral to lumenal side of endoplasmic reticulum membrane	probable	GO:0005783, GO:0005789, GO:0042175, GO:0043229, GO:0030176, GO:0031301, GO:0031300, GO:0043227, GO:0031227, GO:0031224, GO:0005737, GO:0044446, GO:0031090, GO:0016021, GO:0016020, GO:0043226, GO:0044432, GO:0012505, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0044425, GO:0044422

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4HYG, chain A
Confidence level:confident
Coverage over the Query: 49-128,198-220,243-294
View the alignment between query and template
View the model in PyMOL