Diaphorina citri psyllid: psy13087


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170
METEERTLQLPQKRYYRQRAHSNPIADHSVEYPPSPNDMDWSPLYPELKDPTCEKKVEFVDVGCGYGGLLVTLSPMFPSTLILGLEIRVKVSDYVIDRVAALRSQNKGQYENIACIRTNAMKYLPNYFRKAQVRRCFANCILNSQYENIACIRTNAMKYLPNYFRKAQAL
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEcccccHHHHHccccccccEEEEEEEHHHHHHHHHHHHHHHHHccccccccHHHcccHHHHccccccccccccEEEccccccccHHHHHHHHHcHHHHHHHHHHHHHcc
************KRYYRQRAHSNPIADHSVEYPPSPNDMDWSPLYPELKDPTCEKKVEFVDVGCGYGGLLVTLSPMFPSTLILGLEIRVKVSDYVIDRVAALRSQNKGQYENIACIRTNAMKYLPNYFRKAQVRRCFANCILNSQYENIACIRTNAMKYLPNYFRKAQ**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
METEERTLQLPQKRYYRQRAHSNPIADHSVEYPPSPNDMDWSPLYPELKDPTCEKKVEFVDVGCGYGGLLVTLSPMFPSTLILGLEIRVKVSDYVIDRVAALRSQNKGQYENIACIRTNAMKYLPNYFRKAQVRRCFANCILNSQYENIACIRTNAMKYLPNYFRKAQAL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
tRNA (guanine-N(7)-)-methyltransferase Catalyzes the formation of N(7)-methylguanine at position 46 (m7G46) in tRNA.confidentQ6BX78
tRNA (guanine-N(7)-)-methyltransferase Catalyzes the formation of N(7)-methylguanine at position 46 (m7G46) in tRNA.confidentQ6CE12
tRNA (guanine-N(7)-)-methyltransferase Catalyzes the formation of N(7)-methylguanine at position 46 (m7G46) in tRNA.confidentQ23126

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.1.-.-Transferring one-carbon groups.probable
2.1.1.-15-hydroxyprostaglandin-I dehydrogenase (NADP(+)).probable
2.1.1.33tRNA (guanine(46)-N(7))-methyltransferase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2VDV, chain E
Confidence level:very confident
Coverage over the Query: 23-143
View the alignment between query and template
View the model in PyMOL
Template: 3DR5, chain A
Confidence level:confident
Coverage over the Query: 56-150
View the alignment between query and template
View the model in PyMOL