Diaphorina citri psyllid: psy13096

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240----
ENTRTPGGAAGTSVKPTKYHYYPHNQHIYLLPECAVQQENTRTPGGAAGTSVKPTKYHYYPHNQHIYLLPECAVQQVCNAVYVRLNYTQPLCACPSRYREPCSASINSDDFHTTELTTDPQGKVLTLVKTCEPVLDMRLCRSPRDWSLLALQNIRTGKSHYLVICRCPDSSILEGPMSHDQPTYASVPGIRVYGMMCVNRAASVVSTTASVYHTSSTTYRTPTPSKRKSRPLRLSRSVRVSRRK
ccccccccccccccccccEEEcccccEEEEccccHHcccccccccccccccccccCEEEcccccEEEEcccccHHHcccEEEEEEcccccccccccccccccccccccccccCEEECccccccEEEEEEcccccccccccccccccHHEEEEEcccccCEEEEEEEccccccccccccccccccccccccEEEEEEEEEccccccccccccccccccccccccccccccccccccccccccccc
****************TKYHYYPHNQHIYLLPECAVQQ************SVKPTKYHYYPHNQHIYLLPECAVQQVCNAVYVRLNYTQPLCACPSRYREPCSASINSDDFHTTELTTDPQGKVLTLVKTCEPVLDMRLCRSPRDWSLLALQNIRTGKSHYLVICRCPDSSILEGPMSHDQPTYASVPGIRVYGMMCVNRAA******************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ENTRTPGGAAGTSVKPTKYHYYPHNQHIYLLPECAVQQENTRTPGGAAGTSVKPTKYHYYPHNQHIYLLPECAVQQVCNAVYVRLNYTQPLCACPSRYREPCSASINSDDFHTTELTTDPQGKVLTLVKTCEPVLDMRLCRSPRDWSLLALQNIRTGKSHYLVICRCPDSSILEGPMSHDQPTYASVPGIRVYGMMCVNRAASVVSTTASVYHTSSTTYRTPTPSKRKSRPLRLSRSVRVSRRK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfer were detected in SWISS-PROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005576 [CC]extracellular regionprobableGO:0005575
GO:0040003 [BP]chitin-based cuticle developmentprobableGO:0032502, GO:0042335, GO:0044707, GO:0048856, GO:0044767, GO:0032501, GO:0008150, GO:0007275, GO:0044699

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3C9A, chain A
Confidence level:very confident
Coverage over the Query: 58-199
View the alignment between query and template
View the model in PyMOL