Diaphorina citri psyllid: psy130

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------20
MVKLFALNILYKAPTSAVMLKSSYDLQSFSFFQRGSVQEFMTFVSKTMVERSQTASRQSIKEGEYMCHVFVRGDNLAGILVSDQEYPHRVAHTLITNVLNEFSKAVPPSSWPTGTEASISFPQLPQYLARYQNPREADAMTKIQEELDETKIILHNTIEAVLQRGEKLDDLVSKSEGLSMQSKAFYKTARKTNSCCSLG
ccEEEEEEEECcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHccccccccEEEEccEEEEEEEEcccEEEEEEEccccccHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccc
MVKLFALNILYKAPTSAVMLKSSYDLQSFSFFQRGSVQEFMTFVSKTMVE*SQ*ASRQSIKEGEYMCHVFVRGDNLAGILVSDQEYPHRVAHTLITNVLNEFSKAVPPSSWPTGTEASISFPQLPQYLARYQNPREADAMTKIQEELDETKIILHNTIEAVLQRGEKLDDL*****************ARKTNSCCSL*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVKLFALNILYKAPTSAVMLKSSYDLQSFSFFQRGSVQEFMTFVSKTMVERSQTASRQSIKEGEYMCHVFVRGDNLAGILVSDQEYPHRVAHTLITNVLNEFSKAVPPSSWPTGTEASISFPQLPQYLARYQNPREADAMTKIQEELDETKIILHNTIEAVLQRGEKLDDLVSKSEGLSMQSKAFYKTARKTNSCCSLG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Synaptobrevin homolog YKT6 Vesicular soluble NSF attachment protein receptor (v-SNARE) mediating vesicle docking and fusion to a specific acceptor cellular compartment. Functions in endoplasmic reticulum to Golgi transport; as part of a SNARE complex composed of GOSR1, GOSR2 and STX5. Functions in early/recycling endosome to TGN transport; as part of a SNARE complex composed of BET1L, GOSR1 and STX5. Has a S-palmitoyl transferase activity.very confidentQ9CQW1
Synaptobrevin homolog YKT6 Vesicular soluble NSF attachment protein receptor (v-SNARE) mediating vesicle docking and fusion to a specific acceptor cellular compartment. Functions in endoplasmic reticulum to Golgi transport; as part of a SNARE complex composed of GOSR1, GOSR2 and STX5. Functions in early/recycling endosome to TGN transport; as part of a SNARE complex composed of BET1L, GOSR1 and STX5. Has a S-palmitoyl transferase activity.very confidentQ3T000
Synaptobrevin homolog YKT6 Vesicular soluble NSF attachment protein receptor (v-SNARE) mediating vesicle docking and fusion to a specific acceptor cellular compartment. Functions in endoplasmic reticulum to Golgi transport; as part of a SNARE complex composed of GOSR1, GOSR2 and STX5. Functions in early/recycling endosome to TGN transport; as part of a SNARE complex composed of BET1L, GOSR1 and STX5. Has a S-palmitoyl transferase activity.very confidentQ5EGY4

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0006904 [BP]vesicle docking involved in exocytosisconfidentGO:0046903, GO:0006810, GO:0016192, GO:0006887, GO:0044765, GO:0022406, GO:0048278, GO:0032940, GO:0044763, GO:0051649, GO:0008150, GO:0009987, GO:0051234, GO:0051179, GO:0044699, GO:0051641
GO:0006903 [BP]vesicle targetingconfidentGO:0009987, GO:0016192, GO:0051234, GO:0006810, GO:0051179, GO:0044763, GO:0051640, GO:0051648, GO:0051649, GO:0008150, GO:0051656, GO:0051650, GO:0044699, GO:0051641
GO:0005484 [MF]SNAP receptor activityconfidentGO:0003674, GO:0005488, GO:0005515
GO:0006888 [BP]ER to Golgi vesicle-mediated transportconfidentGO:0051234, GO:0016192, GO:0046907, GO:0048193, GO:0006810, GO:0044765, GO:0008150, GO:0051649, GO:0044763, GO:0009987, GO:0051641, GO:0051179, GO:0044699, GO:0016482
GO:0005768 [CC]endosomeconfidentGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0019706 [MF]protein-cysteine S-palmitoleyltransferase activityconfidentGO:0003824, GO:0016417, GO:0016740, GO:0016746, GO:0016747, GO:0019707, GO:0003674, GO:0016409
GO:0005783 [CC]endoplasmic reticulumconfidentGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005739 [CC]mitochondrionconfidentGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0031201 [CC]SNARE complexconfidentGO:0043234, GO:0005737, GO:0032991, GO:0016020, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0044425
GO:0005794 [CC]Golgi apparatusconfidentGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0042147 [BP]retrograde transport, endosome to GolgiconfidentGO:0016197, GO:0009987, GO:0016192, GO:0046907, GO:0006810, GO:0044765, GO:0008150, GO:0051649, GO:0044763, GO:0051234, GO:0051179, GO:0044699, GO:0051641
GO:0005887 [CC]integral to plasma membraneconfidentGO:0031226, GO:0016021, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459, GO:0031224
GO:0006906 [BP]vesicle fusionprobableGO:0006996, GO:0009987, GO:0016192, GO:0008150, GO:0016044, GO:0071840, GO:0006810, GO:0016050, GO:0061025, GO:0061024, GO:0048284, GO:0006944, GO:0044763, GO:0051234, GO:0051179, GO:0044699, GO:0016043
GO:0000003 [BP]reproductionprobableGO:0008150
GO:0009306 [BP]protein secretionprobableGO:0033036, GO:0046903, GO:0006810, GO:0071702, GO:0044765, GO:0045184, GO:0032940, GO:0008104, GO:0044763, GO:0051649, GO:0015031, GO:0008150, GO:0009987, GO:0051234, GO:0051179, GO:0044699, GO:0051641
GO:0002119 [BP]nematode larval developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0009791, GO:0002164, GO:0008150, GO:0007275, GO:0044699
GO:0040011 [BP]locomotionprobableGO:0008150
GO:0040010 [BP]positive regulation of growth rateprobableGO:0045927, GO:0040008, GO:0040009, GO:0065007, GO:0048518, GO:0008150, GO:0050789
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0006898 [BP]receptor-mediated endocytosisprobableGO:0006897, GO:0016192, GO:0006810, GO:0008150, GO:0051234, GO:0051179
GO:0045335 [CC]phagocytic vesicleprobableGO:0005737, GO:0005575, GO:0043231, GO:0016023, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0030139, GO:0043229, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0031982
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0030659 [CC]cytoplasmic vesicle membraneprobableGO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0005575, GO:0031090, GO:0016023, GO:0031410, GO:0016020, GO:0031988, GO:0044433, GO:0012505, GO:0012506, GO:0031982, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044424, GO:0044422
GO:0000324 [CC]fungal-type vacuoleprobableGO:0005737, GO:0000323, GO:0000322, GO:0005773, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226, GO:0043231
GO:0000139 [CC]Golgi membraneprobableGO:0005737, GO:0005794, GO:0031090, GO:0043229, GO:0016020, GO:0044464, GO:0044444, GO:0005623, GO:0005622, GO:0044446, GO:0044431, GO:0012505, GO:0005575, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0009792 [BP]embryo development ending in birth or egg hatchingprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0007275, GO:0044699
GO:0030133 [CC]transport vesicleprobableGO:0005737, GO:0031982, GO:0016023, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0043231
GO:0008152 [BP]metabolic processprobableGO:0008150
GO:0010008 [CC]endosome membraneprobableGO:0005737, GO:0005575, GO:0031090, GO:0043227, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044440, GO:0044424, GO:0005768, GO:0043226, GO:0044422, GO:0043231
GO:0000011 [BP]vacuole inheritanceprobableGO:0006996, GO:0007033, GO:0048308, GO:0009987, GO:0016043, GO:0044763, GO:0071840, GO:0008150, GO:0044699
GO:0036180 [BP]filamentous growth of a population of unicellular organisms in response to biotic stimulusprobableGO:0009607, GO:0040007, GO:0050896, GO:0044182, GO:0008150, GO:0030447, GO:0044699
GO:0006891 [BP]intra-Golgi vesicle-mediated transportprobableGO:0009987, GO:0016192, GO:0046907, GO:0048193, GO:0006810, GO:0044765, GO:0008150, GO:0051649, GO:0044763, GO:0051234, GO:0051179, GO:0044699, GO:0051641
GO:0005774 [CC]vacuolar membraneprobableGO:0005737, GO:0005575, GO:0031090, GO:0005773, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044437, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0071216 [BP]cellular response to biotic stimulusprobableGO:0051716, GO:0009607, GO:0050896, GO:0009987, GO:0044763, GO:0008150, GO:0044699
GO:0042144 [BP]vacuole fusion, non-autophagicprobableGO:0006996, GO:0007033, GO:0016044, GO:0071840, GO:0009987, GO:0016043, GO:0061025, GO:0061024, GO:0044763, GO:0006944, GO:0008150, GO:0044699

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3KYQ, chain A
Confidence level:very confident
Coverage over the Query: 1-193
View the alignment between query and template
View the model in PyMOL