Diaphorina citri psyllid: psy13106


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------
MPLFGKKDSAKKLKKDGKDNEIKGPSIEEKYILKELLGTGAFSEVRLAESRENGTMFAVKIIDKKALKGKEDSLENEIKVLRRFSQSVHNRLDETNDNNSNDKDKERLTHPNIVQLIETFEDKHKVYLVMELVTGGELFDRIVEKGSYTEKDASMLIRQVLEAVDYMHEARYLSKPR
ccccccccccccccccccccccccccccccEEEccEEcccccEEEEEEEEcccccEEEEEEEEcccccccHHHHHHHHHHHHHcccccccccccccccccccccccccccccEEEEEEEEEEcccEEEEEEccccccHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHcccccccc
****************************EKYILKELLGTGAFSEVRLAESRENGTMFAVKIIDKKALKGKEDSLENEIKVLRRFSQSVHNRLDETNDNNSNDKDKERLTHPNIVQLIETFEDKHKVYLVMELVTGGELFDRIVEKGSYTEKDASMLIRQVLEAVDYMHEARYLSKP*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPLFGKKDSAKKLKKDGKDNEIKGPSIEEKYILKELLGTGAFSEVRLAESRENGTMFAVKIIDKKALKGKEDSLENEIKVLRRFSQSVHNRLDETNDNNSNDKDKERLTHPNIVQLIETFEDKHKVYLVMELVTGGELFDRIVEKGSYTEKDASMLIRQVLEAVDYMHEARYLSKPR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Calcium/calmodulin-dependent protein kinase type 1D Calcium/calmodulin-dependent protein kinase that operates in the calcium-triggered CaMKK-CaMK1 signaling cascade and, upon calcium influx, activates CREB-dependent gene transcription, regulates calcium-mediated granulocyte function and respiratory burst and promotes basal dendritic growth of hippocampal neurons. In neutrophil cells, required for cytokine-induced proliferative responses and activation of the respiratory burst. Phosphorylates the transcription activator CREB1 on 'Ser-133' in hippocampal neuron nuclei. May play a role in apoptosis of erythroleukemia cells. In vitro, phosphorylates transcription factor CREM isoform Beta (By similarity). Isoform 1 but not isoform 2 activates CREB1.confidentQ8BW96
Calcium/calmodulin-dependent protein kinase type 1 Calcium/calmodulin-dependent protein kinase belonging to a calcium-triggered signaling cascade which results in transcriptional activation, at least in part through phosphorylation of crh-1. Regulates gene expression, sensory morphology, and function of the AFD thermosensory neurons.confidentQ9TXJ0
Calcium/calmodulin-dependent protein kinase type 1D Calcium/calmodulin-dependent protein kinase that operates in the calcium-triggered CaMKK-CaMK1 signaling cascade and, upon calcium influx, activates CREB-dependent gene transcription, regulates calcium-mediated granulocyte function and respiratory burst and basal dendritic growth of hippocampal neurons. In neutrophil cells, required for cytokine-induced proliferative responses and activation of the respiratory burst. Phosphorylates the transcription activator CREB1 on 'Ser-133' in hippocampal neuron nuclei. May play a role in apoptosis of erythroleukemia cells. In vitro, phosphorylates transcription factor CREM isoform Beta.confidentQ8IU85

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044424 [CC]intracellular partprobableGO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0003674 [MF]molecular_functionprobable

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2BDW, chain A
Confidence level:very confident
Coverage over the Query: 24-83,108-177
View the alignment between query and template
View the model in PyMOL
Template: 3DZO, chain A
Confidence level:confident
Coverage over the Query: 28-112,123-177
View the alignment between query and template
View the model in PyMOL