Diaphorina citri psyllid: psy13137


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160----
MAYMNTAWKNGTRNLWRKTLARVQYTVKAILTKAVLAVGDAGVGGAGGKMNLLNMMDAENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALGNYDPVLNEYFFDRHPGVFAQVLNYYRVFRLPLGFKPWTVCMASYTSELLKKKKKKKKKKKKKKKKKDCHV
cccccHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccEEEEEcccEEEEcHHHHHHccccccccHHHHcccccccccEEEEccccccHHHHHHHHHHcccccccccccccHHHHHHHHHHcccccccHHHHHHHHHHccc
*************NLWRKTLARVQYTVKAILTKAVLAV*****GGAGGKMNLLNMMDAENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALGNYDPVLNEYFFDRHPGVFAQVLNYYRVFRLPLGFKPWTVCMASYTSELLKKKKKKKKKKKKKKK******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAYMNTAWKNGTRNLWRKTLARVQYTVKAILTKAVLAVGDAGVGGAGGKMNLLNMMDAENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALGNYDPVLNEYFFDRHPGVFAQVLNYYRVFRLPLGFKPWTVCMASYTxxxxxxxxxxxxxxxxxxxxxDCHV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Potassium voltage-gated channel subfamily C member 3 This protein mediates the voltage-dependent potassium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a potassium-selective channel through which potassium ions may pass in accordance with their electrochemical gradient.confidentQ63959
Potassium voltage-gated channel subfamily C member 3 This protein mediates the voltage-dependent potassium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a potassium-selective channel through which potassium ions may pass in accordance with their electrochemical gradient.confidentQ14003

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0030673 [CC]axolemmaprobableGO:0044304, GO:0016020, GO:0031256, GO:0044463, GO:0031253, GO:0031252, GO:0005623, GO:0030424, GO:0005575, GO:0097458, GO:0032589, GO:0071944, GO:0043005, GO:0033267, GO:0044464, GO:0005886, GO:0042995, GO:0044459, GO:0044425
GO:0071804 [BP]cellular potassium ion transportprobableGO:0006810, GO:0006813, GO:0006812, GO:0006811, GO:0009987, GO:0051179, GO:0008150, GO:0044765, GO:0030001, GO:0044763, GO:0051234, GO:0015672, GO:0044699
GO:0032809 [CC]neuronal cell body membraneprobableGO:0044298, GO:0043025, GO:0016020, GO:0044297, GO:0005623, GO:0044464, GO:0005575, GO:0097458, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0032590 [CC]dendrite membraneprobableGO:0016020, GO:0031256, GO:0044463, GO:0031253, GO:0031252, GO:0005623, GO:0044464, GO:0005575, GO:0097458, GO:0032589, GO:0071944, GO:0043005, GO:0005886, GO:0044425, GO:0042995, GO:0044459
GO:0043679 [CC]axon terminusprobableGO:0044306, GO:0044463, GO:0044464, GO:0005623, GO:0030424, GO:0005575, GO:0097458, GO:0043005, GO:0033267, GO:0042995
GO:0031594 [CC]neuromuscular junctionprobableGO:0005575, GO:0045202
GO:0050794 [BP]regulation of cellular processprobableGO:0008150, GO:0065007, GO:0050789
GO:0005783 [CC]endoplasmic reticulumprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0030431 [BP]sleepprobableGO:0032501, GO:0008150, GO:0044699, GO:0044707
GO:0051259 [BP]protein oligomerizationprobableGO:0022607, GO:0071822, GO:0070271, GO:0043933, GO:0006461, GO:0016043, GO:0065003, GO:0044085, GO:0008150, GO:0071840
GO:0034220 [BP]ion transmembrane transportprobableGO:0009987, GO:0006811, GO:0006810, GO:0051179, GO:0044765, GO:0044763, GO:0008150, GO:0051234, GO:0055085, GO:0044699
GO:0030425 [CC]dendriteprobableGO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0005249 [MF]voltage-gated potassium channel activityprobableGO:0005267, GO:0005261, GO:0003674, GO:0015077, GO:0022843, GO:0022803, GO:0046873, GO:0005215, GO:0005216, GO:0008324, GO:0022891, GO:0022890, GO:0022892, GO:0005244, GO:0015075, GO:0022832, GO:0022857, GO:0015267, GO:0022836, GO:0022839, GO:0022838, GO:0015079
GO:0005887 [CC]integral to plasma membraneprobableGO:0031226, GO:0016021, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459, GO:0031224

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3KVT, chain A
Confidence level:very confident
Coverage over the Query: 59-149
View the alignment between query and template
View the model in PyMOL