Diaphorina citri psyllid: psy13140

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120--
MSSSLDRIREDCPLDKDQLGYQTWGLLHTIAAYYPEKPTADEEREMKTFFMLLGKFYPCESCARDFSSLLKLRPPATSSQRALAGWLCWVHNHINQKLGKPQFDCSRLDERWRDGWDDGSCD
ccccccccccccccccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHccccccccccHHHHHcccccccccc
************PLDKDQLGYQTWGLLHTIAAYYPEKPTADEEREMKTFFMLLGKFYPCESCARDFSSLLKLRPPATSSQRALAGWLCWVHNHINQKLGKPQFDCSRLDERWRDGWDDG*C*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSSLDRIREDCPLDKDQLGYQTWGLLHTIAAYYPEKPTADEEREMKTFFMLLGKFYPCESCARDFSSLLKLRPPATSSQRALAGWLCWVHNHINQKLGKPQFDCSRLDERWRDGWDDGSCD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
FAD-linked sulfhydryl oxidase ALR FAD-dependent sulfhydryl oxidase. Within the mitochondrial intermembrane space, participates in a chain of disulfide exchange reactions with MIA40, that generate disulfide bonds in a number of resident proteins with twin Cx3C and Cx9C motifs.confidentP56213
FAD-linked sulfhydryl oxidase ERV1 FAD-dependent sulfhydryl oxidase that catalyzes disulfide bond formation. Oxidizes thioredoxin in vitro.confidentQ8GXX0
FAD-linked sulfhydryl oxidase ALR Isoform 2: May act as an autocrine hepatotrophic growth factor promoting liver regeneration.confidentP55789

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0016972 [MF]thiol oxidase activityprobableGO:0003824, GO:0016670, GO:0003674, GO:0016667, GO:0016491
GO:0031012 [CC]extracellular matrixprobableGO:0005575
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0042803 [MF]protein homodimerization activityprobableGO:0046983, GO:0003674, GO:0005515, GO:0042802, GO:0005488
GO:0044699 [BP]single-organism processprobableGO:0008150
GO:0050660 [MF]flavin adenine dinucleotide bindingprobableGO:0043168, GO:0050662, GO:0097159, GO:0043167, GO:0036094, GO:0048037, GO:0005488, GO:0003674, GO:0000166, GO:1901363, GO:1901265
GO:0015035 [MF]protein disulfide oxidoreductase activityprobableGO:0003824, GO:0016491, GO:0003674, GO:0016667, GO:0015036

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
1.-.-.-Oxidoreductases.probable
1.8.-.-Acting on a sulfur group of donors.probable
1.8.3.-With oxygen as acceptor.probable
1.8.3.2Thiol oxidase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2HJ3, chain A
Confidence level:very confident
Coverage over the Query: 13-113
View the alignment between query and template
View the model in PyMOL