Diaphorina citri psyllid: psy13151

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250------

MFTYHAGTASYLVVVAVDIRRTDPHIGNTPACSCVESYIGRPPNCRPECTINAECAGNLACINERCKDPCPGSCGAHASCVVLNHTPRCTCDPGFTGDPFSTCFYIQERNHMVMGSRDQMVLVVGQQLLERKSTAAPVAAEPRPSGNPCLPSPCGPNSICRVIGNTPACSCVESYIGRPPNCRPECTINAECAGNLACINERCKDPCPGSCGAHASCVVLNHTPRCTCDPGFTGDPFSTCFYIQESKHPNRRLVTF

ccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccEEEEcccccEEEccccccccccccccccccccccccccccccEEEcccEEECccccccccccccccccccccccccccccEEEEcccccEEEcccccCCccccccccccccccccccccccccccccccccccccccEEEEcccccEEEccccccccccccccccccccccccccccc

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005488 [MF]	binding	probable	GO:0003674
GO:0046331 [BP]	lateral inhibition	probable	GO:0032502, GO:0044700, GO:0045165, GO:0048869, GO:0030154, GO:0045168, GO:0008150, GO:0044763, GO:0023052, GO:0007267, GO:0007154, GO:0009987, GO:0044699
GO:0008362 [BP]	chitin-based embryonic cuticle biosynthetic process	probable	GO:0032502, GO:0040003, GO:0042335, GO:0044707, GO:0048856, GO:0044767, GO:0032501, GO:0008150, GO:0007275, GO:0044699
GO:0007475 [BP]	apposition of dorsal and ventral imaginal disc-derived wing surfaces	probable	GO:0048563, GO:0048569, GO:0008587, GO:0009887, GO:0035220, GO:0009791, GO:0035120, GO:0002165, GO:0032501, GO:0009653, GO:0007275, GO:0044699, GO:0007472, GO:0007552, GO:0007476, GO:0048513, GO:0032502, GO:0048707, GO:0009886, GO:0035107, GO:0035114, GO:0008150, GO:0044767, GO:0044707, GO:0007444, GO:0048856, GO:0007560, GO:0048731, GO:0048736, GO:0048737
GO:0005575 [CC]	cellular_component	probable
GO:0007424 [BP]	open tracheal system development	probable	GO:0060541, GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0040005 [BP]	chitin-based cuticle attachment to epithelium	probable	GO:0032501, GO:0044707, GO:0007591, GO:0022404, GO:0008150, GO:0042303, GO:0044699

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2YGQ, chain A
Confidence level:confident
Coverage over the Query: 15-55,71-145
View the alignment between query and template
View the model in PyMOL

Template: 2BOU, chain A
Confidence level:confident
Coverage over the Query: 71-107,138-195,208-247
View the alignment between query and template
View the model in PyMOL

Template: 4D90, chain A
Confidence level:confident
Coverage over the Query: 13-105,146-178
View the alignment between query and template
View the model in PyMOL

Template: 4FBR, chain A
Confidence level:confident
Coverage over the Query: 14-235
View the alignment between query and template
View the model in PyMOL