Psyllid ID: psy13151


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250------
MFTYHAGTASYLVVVAVDIRRTDPHIGNTPACSCVESYIGRPPNCRPECTINAECAGNLACINERCKDPCPGSCGAHASCVVLNHTPRCTCDPGFTGDPFSTCFYIQERNHMVMGSRDQMVLVVGQQLLERKSTAAPVAAEPRPSGNPCLPSPCGPNSICRVIGNTPACSCVESYIGRPPNCRPECTINAECAGNLACINERCKDPCPGSCGAHASCVVLNHTPRCTCDPGFTGDPFSTCFYIQESKHPNRRLVTF
ccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccEEEEcccccEEEccccccccccccccccccccccccccccccEEEcccEEEEccccccccccccccccccccccccccccEEEEcccccEEEcccccEEccccccccccccccccccccccccccccccccccccccEEEEcccccEEEccccccccccccccccccccccccccccc
ccccccccHHHHHEEEEHcccccccccccEEEEcccccccccccccccccccccccccHHHHccccccccccccccccEEEEEccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEccccEEEEccccccccccccccccEccccccccHHHHccccccccccccccccEEEEEccccEEEcccccccccccccccccccccccccEEEc
MFTYHAGTASYLVVVAVDirrtdphigntpacscvesyigrppncrpectinaecagnlacinerckdpcpgscgahascvvlnhtprctcdpgftgdpfstcfyiqernhmvmgsRDQMVLVVGQQLlerkstaapvaaeprpsgnpclpspcgpnsicrvigntpacscvesyigrppncrpectinaecagnlacinerckdpcpgscgahascvvlnhtprctcdpgftgdpfstcfyiqeskhpnrrlvtf
mftyhagtaSYLVVVAVDIRRTDPHIGNTPACSCVESYIGRPPNCRPECTINAECAGNLACINERCKDPCPGSCGAHASCVVLNHTPRCTCDPGFTGDPFSTCFYIQERNHMVMGSRDQMVLVVGQQLLERKSTAapvaaeprpsgnpcLPSPCGPNSICRVIGNTPACSCVESYIGRPPNCRPECTINAECAGNLACINERCKDPCPGSCGAHASCVVLNHTPRCTCDPGFTGDPFSTCFyiqeskhpnrrlvtf
MFTYHAGTASYLVVVAVDIRRTDPHIGNTPACSCVESYIGRPPNCRPECTINAECAGNLACINERCKDPCPGSCGAHASCVVLNHTPRCTCDPGFTGDPFSTCFYIQERNHMVMGSRDQMVLVVGQQLLERKSTAAPVAAEPRPSGNPCLPSPCGPNSICRVIGNTPACSCVESYIGRPPNCRPECTINAECAGNLACINERCKDPCPGSCGAHASCVVLNHTPRCTCDPGFTGDPFSTCFYIQESKHPNRRLVTF
**TYHAGTASYLVVVAVDIRRTDPHIGNTPACSCVESYIGRPPNCRPECTINAECAGNLACINERCKDPCPGSCGAHASCVVLNHTPRCTCDPGFTGDPFSTCFYIQERNHMVMGSRDQMVLVVGQQLL************************CGPNSICRVIGNTPACSCVESYIGRPPNCRPECTINAECAGNLACINERCKDPCPGSCGAHASCVVLNHTPRCTCDPGFTGDPFSTCFYIQ************
MFTYHAGTASYLVVVAVDIRRTDPHIGNTPACSCVESYIGRPPNCRPECTINAECAGNLACINERCKDPCPGSCGAHASCVVLNHTPRCTCDPGFTGDPFSTCFYIQERNHMVMGSRDQMVLVVGQQLLERKSTAAPVAAEPRPSGNPCLPSPCGPNSICRVIGNTPACSCVESYIGRPPNCRPECTINAECAGNLACINERCKDPCPGSCGAHASCVVLNHTPRCTCDPGFTGDPFSTCFYIQESKHP***LVT*
MFTYHAGTASYLVVVAVDIRRTDPHIGNTPACSCVESYIGRPPNCRPECTINAECAGNLACINERCKDPCPGSCGAHASCVVLNHTPRCTCDPGFTGDPFSTCFYIQERNHMVMGSRDQMVLVVGQQLLER****************PCLPSPCGPNSICRVIGNTPACSCVESYIGRPPNCRPECTINAECAGNLACINERCKDPCPGSCGAHASCVVLNHTPRCTCDPGFTGDPFSTCFYIQESKHPNRRLVTF
*FTYHAGTASYLVVVAVDIRRTDPHIGNTPACSCVESYIGRPPNCRPECTINAECAGNLACINERCKDPCPGSCGAHASCVVLNHTPRCTCDPGFTGDPFSTCFYIQERNHMVMGSRDQMVLVVGQQLLERKSTAAPVAAEPRPSGNPCLPSPCGPNSICRVIGNTPACSCVESYIGRPPNCRPECTINAECAGNLACINERCKDPCPGSCGAHASCVVLNHTPRCTCDPGFTGDPFSTCFYIQESKHPNRRLVTF
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFTYHAGTASYLVVVAVDIRRTDPHIGNTPACSCVESYIGRPPNCRPECTINAECAGNLACINERCKDPCPGSCGAHASCVVLNHTPRCTCDPGFTGDPFSTCFYIQERNHMVMGSRDQMVLVVGQQLLERKSTAAPVAAEPRPSGNPCLPSPCGPNSICRVIGNTPACSCVESYIGRPPNCRPECTINAECAGNLACINERCKDPCPGSCGAHASCVVLNHTPRCTCDPGFTGDPFSTCFYIQESKHPNRRLVTF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query256 2.2.26 [Sep-21-2011]
Q9UQP3 1299 Tenascin-N OS=Homo sapien yes N/A 0.242 0.047 0.36 0.0009
>sp|Q9UQP3|TENN_HUMAN Tenascin-N OS=Homo sapiens GN=TNN PE=1 SV=2 Back     alignment and function desciption
 Score = 44.3 bits (103), Expect = 9e-04,   Method: Composition-based stats.
 Identities = 27/75 (36%), Positives = 34/75 (45%), Gaps = 13/75 (17%)

Query: 32  CSCVESYIGRP---PNCRPECTINAECA-GNLAC----INERCKDP-CPGSCGAHASCVV 82
           C C E Y+G     P C   C+ + EC  G   C    ++E C +  CPG C  H  C  
Sbjct: 186 CLCHEPYVGADCGYPACPENCSGHGECVRGVCQCHEDFMSEDCSEKRCPGDCSGHGFC-- 243

Query: 83  LNHTPRCTCDPGFTG 97
              T  C C+ GFTG
Sbjct: 244 --DTGECYCEEGFTG 256




Involved in neurite outgrowth and cell migration in hippocampal explants.
Homo sapiens (taxid: 9606)

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query256
328714521 16577 PREDICTED: hypothetical protein LOC10016 0.746 0.011 0.536 2e-59
157133855 5644 hypothetical protein AaeL_AAEL012910 [Ae 0.761 0.034 0.526 9e-59
270013391 21117 hypothetical protein TcasGA2_TC011986 [T 0.742 0.008 0.540 6e-58
170059514 3468 tenascin [Culex quinquefasciatus] gi|167 0.714 0.052 0.549 1e-57
195342490 14551 GM18084 [Drosophila sechellia] gi|194132 0.882 0.015 0.470 1e-56
442625922 14825 dumpy, isoform X [Drosophila melanogaste 0.753 0.013 0.520 1e-55
386769088 15105 dumpy, isoform J [Drosophila melanogaste 0.753 0.012 0.520 1e-55
158299050 2257 AGAP010023-PA [Anopheles gambiae str. PE 0.761 0.086 0.523 1e-55
386769086 15638 dumpy, isoform I [Drosophila melanogaste 0.753 0.012 0.520 2e-55
170059510 6860 dumpy [Culex quinquefasciatus] gi|167878 0.789 0.029 0.526 2e-55
>gi|328714521|ref|XP_003245382.1| PREDICTED: hypothetical protein LOC100166039 [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  234 bits (598), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 118/220 (53%), Positives = 149/220 (67%), Gaps = 29/220 (13%)

Query: 26   IGNTPACSCVESYIGRPPNCRPECTINAECAGNLACINERCKDPCPGSCGAHASCVVLNH 85
            + N   CSC   YIG PP+CRPEC +++EC  + AC+ ++C DPCPG+CG++  C V+NH
Sbjct: 6489 VNNHAVCSCQTDYIGTPPSCRPECMVSSECPQDKACVRKKCIDPCPGTCGSNGRCQVVNH 6548

Query: 86   TPRCTCDPGFTGDPFSTCFYIQERNHMVMGSRDQMVLVVGQQLLERKSTAAPVAAEPRPS 145
             P C+C PG+ GDPF  CF +                      +E      P        
Sbjct: 6549 NPICSCPPGYNGDPFVRCFKV---------------------YIEPPPADIPT------- 6580

Query: 146  GNPCLPSPCGPNSICRVIGNTPACSCVESYIGRPPNCRPECTINAECAGNLACINERCKD 205
             NPC+PSPCGPNS+CR IG+TPACSC++SYIGRPPNCRPECTINAEC GNLAC  ERCKD
Sbjct: 6581 -NPCVPSPCGPNSVCREIGHTPACSCLDSYIGRPPNCRPECTINAECPGNLACSKERCKD 6639

Query: 206  PCPGSCGAHASCVVLNHTPRCTCDPGFTGDPFSTCFYIQE 245
            PCPGSCG +A+CV +NH+P+C C+PG+TGDPF+ C  IQ+
Sbjct: 6640 PCPGSCGIYATCVTINHSPQCNCEPGYTGDPFAGCSLIQQ 6679




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|157133855|ref|XP_001663042.1| hypothetical protein AaeL_AAEL012910 [Aedes aegypti] gi|108870666|gb|EAT34891.1| AAEL012910-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|270013391|gb|EFA09839.1| hypothetical protein TcasGA2_TC011986 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|170059514|ref|XP_001865396.1| tenascin [Culex quinquefasciatus] gi|167878262|gb|EDS41645.1| tenascin [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|195342490|ref|XP_002037833.1| GM18084 [Drosophila sechellia] gi|194132683|gb|EDW54251.1| GM18084 [Drosophila sechellia] Back     alignment and taxonomy information
>gi|442625922|ref|NP_001260039.1| dumpy, isoform X [Drosophila melanogaster] gi|440213324|gb|AGB92575.1| dumpy, isoform X [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|386769088|ref|NP_001245876.1| dumpy, isoform J [Drosophila melanogaster] gi|383291324|gb|AFH03552.1| dumpy, isoform J [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|158299050|ref|XP_001689174.1| AGAP010023-PA [Anopheles gambiae str. PEST] gi|157014182|gb|EDO63447.1| AGAP010023-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|386769086|ref|NP_001245875.1| dumpy, isoform I [Drosophila melanogaster] gi|383291323|gb|AFH03551.1| dumpy, isoform I [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|170059510|ref|XP_001865394.1| dumpy [Culex quinquefasciatus] gi|167878260|gb|EDS41643.1| dumpy [Culex quinquefasciatus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query256
FB|FBgn005319622 dp "dumpy" [Drosophila melanog 0.804 9.363 0.474 2.2e-51
RGD|2318639232 LOC100365646 "hypothetical pro 0.773 0.853 0.267 4.1e-09
UNIPROTKB|F1NS18 2532 ODZ3 "Uncharacterized protein" 0.718 0.072 0.275 5.4e-09
UNIPROTKB|F1P1R1 2567 ODZ3 "Uncharacterized protein" 0.718 0.071 0.275 5.4e-09
UNIPROTKB|Q9P273 2699 TENM3 "Teneurin-3" [Homo sapie 0.718 0.068 0.279 7.6e-09
MGI|MGI:95490 2907 Fbn2 "fibrillin 2" [Mus muscul 0.589 0.051 0.290 8.7e-09
UNIPROTKB|F1PQK8 2546 STAB2 "Uncharacterized protein 0.75 0.075 0.289 9.6e-09
UNIPROTKB|E1C4G9 1182 E1C4G9 "Uncharacterized protei 0.488 0.105 0.285 1.5e-08
UNIPROTKB|Q9BYR4195 KRTAP4-3 "Keratin-associated p 0.289 0.379 0.337 0.00074
FB|FBgn0004647 2703 N "Notch" [Drosophila melanoga 0.507 0.048 0.317 1.6e-08
FB|FBgn0053196 dp "dumpy" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 560 (202.2 bits), Expect = 2.2e-51, P = 2.2e-51
 Identities = 104/219 (47%), Positives = 126/219 (57%)

Query:    28 NTPACSCVESYIGRP-PNCRPECTINAECAGNLACINERCKDPCPGSCGAHASCVVLNHT 86
             N   C+C+  Y G P   CRPEC  +A+C+  LAC   +C DPCPG+C  +A C VLNH 
Sbjct: 15040 NNGVCTCIPEYHGDPYSGCRPECITSADCSRELACSRNKCFDPCPGTCAPNAICTVLNHV 15099

Query:    87 PRCTCDPGFTGDPFSTCFYIQERNHMVMGSRDQMVLVVGQQLLERKSTAAPVAAEPRPSG 146
             P CTC  G+ G+ F  C   +        SR         QL +     AP   +P    
Sbjct: 15100 PMCTCPEGYNGNAFVQC---KPTPRKYFPSRP-CSKPNDTQLND--FLPAPALVQP---- 15149

Query:   147 NPCLPSPCGPNSICRVIGNTPACSCVESYIGRPPNCRPECTINAECAGNLACINERCKDP 206
               C PSPCGPNS CR +     CSCV  YIG PP CRPECT N+EC  +LAC+N++C DP
Sbjct: 15150 --CQPSPCGPNSQCREVNQQAVCSCVPGYIGTPPLCRPECTSNSECLSHLACVNQKCNDP 15207

Query:   207 CPGSCGAHASCVVLNHTPRCTCDPGFTGDPFSTCFYIQE 245
             CPGSCG +A C V+NH P CTC P FTG+PF  C  I E
Sbjct: 15208 CPGSCGRNAQCSVVNHNPFCTCLPRFTGNPFVGCQQIIE 15246


GO:0007475 "apposition of dorsal and ventral imaginal disc-derived wing surfaces" evidence=IMP
GO:0005578 "proteinaceous extracellular matrix" evidence=NAS
GO:0007424 "open tracheal system development" evidence=IMP
GO:0051539 "4 iron, 4 sulfur cluster binding" evidence=IEA
GO:0004867 "serine-type endopeptidase inhibitor activity" evidence=IEA
GO:0004519 "endonuclease activity" evidence=IEA
GO:0005509 "calcium ion binding" evidence=IEA
GO:0008362 "chitin-based embryonic cuticle biosynthetic process" evidence=IMP
GO:0040005 "chitin-based cuticle attachment to epithelium" evidence=IMP
GO:0031012 "extracellular matrix" evidence=ISM
GO:0005201 "extracellular matrix structural constituent" evidence=ISM
GO:0046331 "lateral inhibition" evidence=IMP
RGD|2318639 LOC100365646 "hypothetical protein LOC100365646" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1NS18 ODZ3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1P1R1 ODZ3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q9P273 TENM3 "Teneurin-3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:95490 Fbn2 "fibrillin 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1PQK8 STAB2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E1C4G9 E1C4G9 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q9BYR4 KRTAP4-3 "Keratin-associated protein 4-3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
FB|FBgn0004647 N "Notch" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 256
KOG1214|consensus 1289 99.72
KOG1214|consensus 1289 99.71
KOG1219|consensus 4289 99.38
KOG1217|consensus487 99.27
KOG1219|consensus 4289 99.25
KOG1217|consensus 487 99.2
KOG4260|consensus350 99.08
KOG4289|consensus 2531 98.94
KOG4289|consensus 2531 98.92
KOG4260|consensus350 98.8
KOG1225|consensus 525 98.66
PF1294736 EGF_3: EGF domain; InterPro: IPR024731 This entry 98.3
PF0764542 EGF_CA: Calcium-binding EGF domain; InterPro: IPR0 98.28
PF0764542 EGF_CA: Calcium-binding EGF domain; InterPro: IPR0 98.19
KOG1225|consensus525 98.11
PF1294736 EGF_3: EGF domain; InterPro: IPR024731 This entry 98.04
PF1266224 cEGF: Complement Clr-like EGF-like 97.97
PF0000832 EGF: EGF-like domain This is a sub-family of the P 97.89
PF06247197 Plasmod_Pvs28: Plasmodium ookinete surface protein 97.85
PF0000832 EGF: EGF-like domain This is a sub-family of the P 97.74
smart0017939 EGF_CA Calcium-binding EGF-like domain. 97.7
smart0017939 EGF_CA Calcium-binding EGF-like domain. 97.48
PF1266224 cEGF: Complement Clr-like EGF-like 97.32
cd0005438 EGF_CA Calcium-binding EGF-like domain, present in 97.3
KOG1226|consensus783 97.29
cd0005438 EGF_CA Calcium-binding EGF-like domain, present in 97.27
cd0005336 EGF Epidermal growth factor domain, found in epide 97.03
smart0018135 EGF Epidermal growth factor-like domain. 96.99
PF06247197 Plasmod_Pvs28: Plasmodium ookinete surface protein 96.96
smart0018135 EGF Epidermal growth factor-like domain. 96.81
cd0005336 EGF Epidermal growth factor domain, found in epide 96.67
PF1467036 FXa_inhibition: Coagulation Factor Xa inhibitory s 96.09
PF0797432 EGF_2: EGF-like domain; InterPro: IPR013111 A sequ 95.97
PF0797432 EGF_2: EGF-like domain; InterPro: IPR013111 A sequ 95.84
KOG0994|consensus 1758 95.83
KOG1226|consensus 783 95.75
KOG0994|consensus 1758 95.73
PF1266113 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E 95.71
PF1467036 FXa_inhibition: Coagulation Factor Xa inhibitory s 95.18
PF0906434 Tme5_EGF_like: Thrombomodulin like fifth domain, E 94.38
PF1294637 EGF_MSP1_1: MSP1 EGF domain 1; InterPro: IPR024730 93.61
PF1294637 EGF_MSP1_1: MSP1 EGF domain 1; InterPro: IPR024730 93.33
cd01475224 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, 89.97
PF0168352 EB: EB module; InterPro: IPR006149 The EB domain h 88.94
smart0005163 DSL delta serrate ligand. 88.12
cd01475224 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, 87.75
PHA02887126 EGF-like protein; Provisional 87.64
smart0005163 DSL delta serrate ligand. 87.12
PF00954110 S_locus_glycop: S-locus glycoprotein family; Inter 83.38
PHA03099139 epidermal growth factor-like protein (EGF-like pro 82.38
PF00954110 S_locus_glycop: S-locus glycoprotein family; Inter 81.26
>KOG1214|consensus Back     alignment and domain information
Probab=99.72  E-value=8.5e-17  Score=143.66  Aligned_cols=197  Identities=22%  Similarity=0.434  Sum_probs=143.5

Q ss_pred             CCCceeeCCCCCc--cCCCCCc----------cCCCCCCCCCCCCcccCC----CccCCC---CCCCCCCCeeeeCC-CC
Q psy13151         27 GNTPACSCVESYI--GRPPNCR----------PECTINAECAGNLACINE----RCKDPC---PGSCGAHASCVVLN-HT   86 (256)
Q Consensus        27 ~g~~~C~C~~G~~--g~~~~C~----------~~C~~~~~C~~~~~C~~~----~C~~~C---~~~C~~~~~C~n~~-g~   86 (256)
                      .+-++|.+.+.|.  ++++.+.          .++.....++....++..    .=+++|   ++.|..++.|.... -.
T Consensus       636 ityq~C~h~~~~p~~p~tqql~vd~vfalyn~ee~~lr~a~Sn~igpV~E~S~~~~~npCy~gsh~cdt~a~C~pg~~~~  715 (1289)
T KOG1214|consen  636 ITYQVCRHAPRHPSFPTTQQLNVDRVFALYNDEERVLRFAVSNQIGPVKEDSDPTPVNPCYDGSHMCDTTARCHPGTGVD  715 (1289)
T ss_pred             ceeEEeecCCCCCCCCCceEeecccceeccCccccchhhhhhhcccceecCCCCcccccceecCcccCCCccccCCCCcc
Confidence            4567899988886  4443332          122222234333333332    112556   67899899998654 46


Q ss_pred             ceeeCCCCCccCCCCCCccccccCC--CCCCCCCceEecCCceeeecCCCCcCCCC-CCCCC------CCCCC--CCCCC
Q psy13151         87 PRCTCDPGFTGDPFSTCFYIQERNH--MVMGSRDQMVLVVGQQLLERKSTAAPVAA-EPRPS------GNPCL--PSPCG  155 (256)
Q Consensus        87 ~~C~C~~G~~g~~~~~C~~~~~c~~--~~~~~~~~c~~~~g~~~c~c~~g~~~~~~-~~c~~------~~~C~--~~~C~  155 (256)
                      |+|.|..||.|++.. |.++++|+.  ..|+.+..|++.+++++|.|..||.+..+ ..|..      ++.|.  .+.|.
T Consensus       716 ~tcecs~g~~gdgr~-c~d~~eca~~~~~CGp~s~Cin~pg~~rceC~~gy~F~dd~~tCV~i~~pap~n~Ce~g~h~C~  794 (1289)
T KOG1214|consen  716 YTCECSSGYQGDGRN-CVDENECATGFHRCGPNSVCINLPGSYRCECRSGYEFADDRHTCVLITPPAPANPCEDGSHTCA  794 (1289)
T ss_pred             eEEEEeeccCCCCCC-CCChhhhccCCCCCCCCceeecCCCceeEEEeecceeccCCcceEEecCCCCCCccccCccccC
Confidence            899999999999864 999999986  44889999999999999999999988754 45543      45565  26676


Q ss_pred             CCC--EEeecC-CCCeeecCCCcccCCCCCcccCCcCCCCCCCCeeeCCcccCCCCCCCCCCCeEeeCCCCceeeCCCCC
Q psy13151        156 PNS--ICRVIG-NTPACSCVESYIGRPPNCRPECTINAECAGNLACINERCKDPCPGSCGAHASCVVLNHTPRCTCDPGF  232 (256)
Q Consensus       156 ~~~--~C~~~~-g~~~C~C~~G~~~~~~~c~~~C~~~~~C~~~~~C~~~~C~~~C~~~C~~~~~C~~~~g~~~C~C~~G~  232 (256)
                      .++  +|+... ++|.|.|.+||.|++..|    .+.++|..              +.|+++|+|+|++|+|.|.|.+||
T Consensus       795 i~g~a~c~~hGgs~y~C~CLPGfsGDG~~c----~dvDeC~p--------------srChp~A~CyntpgsfsC~C~pGy  856 (1289)
T KOG1214|consen  795 IAGQARCVHHGGSTYSCACLPGFSGDGHQC----TDVDECSP--------------SRCHPAATCYNTPGSFSCRCQPGY  856 (1289)
T ss_pred             cCCceEEEecCCceEEEeecCCccCCcccc----ccccccCc--------------cccCCCceEecCCCcceeecccCc
Confidence            544  455555 459999999999998754    34456653              459999999999999999999999


Q ss_pred             ccCCCCCCccc
Q psy13151        233 TGDPFSTCFYI  243 (256)
Q Consensus       233 ~g~~~~~C~~i  243 (256)
                      .|++.. |++-
T Consensus       857 ~GDGf~-CVP~  866 (1289)
T KOG1214|consen  857 YGDGFQ-CVPD  866 (1289)
T ss_pred             cCCCce-ecCC
Confidence            999998 8763



>KOG1214|consensus Back     alignment and domain information
>KOG1219|consensus Back     alignment and domain information
>KOG1217|consensus Back     alignment and domain information
>KOG1219|consensus Back     alignment and domain information
>KOG1217|consensus Back     alignment and domain information
>KOG4260|consensus Back     alignment and domain information
>KOG4289|consensus Back     alignment and domain information
>KOG4289|consensus Back     alignment and domain information
>KOG4260|consensus Back     alignment and domain information
>KOG1225|consensus Back     alignment and domain information
>PF12947 EGF_3: EGF domain; InterPro: IPR024731 This entry represents an EGF domain found in the the C terminus of malarial parasite merozoite surface protein 1 [], as well as other proteins Back     alignment and domain information
>PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins Back     alignment and domain information
>PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins Back     alignment and domain information
>KOG1225|consensus Back     alignment and domain information
>PF12947 EGF_3: EGF domain; InterPro: IPR024731 This entry represents an EGF domain found in the the C terminus of malarial parasite merozoite surface protein 1 [], as well as other proteins Back     alignment and domain information
>PF12662 cEGF: Complement Clr-like EGF-like Back     alignment and domain information
>PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>PF06247 Plasmod_Pvs28: Plasmodium ookinete surface protein Pvs28; InterPro: IPR010423 This family consists of several ookinete surface protein (Pvs28) from several species of Plasmodium Back     alignment and domain information
>PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>smart00179 EGF_CA Calcium-binding EGF-like domain Back     alignment and domain information
>smart00179 EGF_CA Calcium-binding EGF-like domain Back     alignment and domain information
>PF12662 cEGF: Complement Clr-like EGF-like Back     alignment and domain information
>cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>KOG1226|consensus Back     alignment and domain information
>cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium Back     alignment and domain information
>smart00181 EGF Epidermal growth factor-like domain Back     alignment and domain information
>PF06247 Plasmod_Pvs28: Plasmodium ookinete surface protein Pvs28; InterPro: IPR010423 This family consists of several ookinete surface protein (Pvs28) from several species of Plasmodium Back     alignment and domain information
>smart00181 EGF Epidermal growth factor-like domain Back     alignment and domain information
>cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium Back     alignment and domain information
>PF14670 FXa_inhibition: Coagulation Factor Xa inhibitory site; PDB: 3Q3K_B 1NFY_B 1LQD_A 1G2L_B 1IQF_L 2UWP_B 2VH6_B 3KQC_L 2P93_L 2BQW_A Back     alignment and domain information
>PF07974 EGF_2: EGF-like domain; InterPro: IPR013111 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>PF07974 EGF_2: EGF-like domain; InterPro: IPR013111 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>KOG0994|consensus Back     alignment and domain information
>KOG1226|consensus Back     alignment and domain information
>KOG0994|consensus Back     alignment and domain information
>PF12661 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E26_A 3A7Q_A 2YGP_A 2YGO_A 1HRE_A 1HAE_A 1HAF_A 1HRF_A Back     alignment and domain information
>PF14670 FXa_inhibition: Coagulation Factor Xa inhibitory site; PDB: 3Q3K_B 1NFY_B 1LQD_A 1G2L_B 1IQF_L 2UWP_B 2VH6_B 3KQC_L 2P93_L 2BQW_A Back     alignment and domain information
>PF09064 Tme5_EGF_like: Thrombomodulin like fifth domain, EGF-like; InterPro: IPR015149 This domain adopts a fold similar to other EGF domains, with a flat major and a twisted minor beta sheet Back     alignment and domain information
>PF12946 EGF_MSP1_1: MSP1 EGF domain 1; InterPro: IPR024730 This EGF-like domain is found at the C terminus of the malaria parasite MSP1 protein Back     alignment and domain information
>PF12946 EGF_MSP1_1: MSP1 EGF domain 1; InterPro: IPR024730 This EGF-like domain is found at the C terminus of the malaria parasite MSP1 protein Back     alignment and domain information
>cd01475 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, extracellular matrix molecules mediate cell-matrix and matrix-matrix interactions thereby providing tissue integrity Back     alignment and domain information
>PF01683 EB: EB module; InterPro: IPR006149 The EB domain has no known function Back     alignment and domain information
>smart00051 DSL delta serrate ligand Back     alignment and domain information
>cd01475 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, extracellular matrix molecules mediate cell-matrix and matrix-matrix interactions thereby providing tissue integrity Back     alignment and domain information
>PHA02887 EGF-like protein; Provisional Back     alignment and domain information
>smart00051 DSL delta serrate ligand Back     alignment and domain information
>PF00954 S_locus_glycop: S-locus glycoprotein family; InterPro: IPR000858 In Brassicaceae, self-incompatible plants have a self/non-self recognition system, which involves the inability of flowering plants to achieve self-fertilisation Back     alignment and domain information
>PHA03099 epidermal growth factor-like protein (EGF-like protein); Provisional Back     alignment and domain information
>PF00954 S_locus_glycop: S-locus glycoprotein family; InterPro: IPR000858 In Brassicaceae, self-incompatible plants have a self/non-self recognition system, which involves the inability of flowering plants to achieve self-fertilisation Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query256
3poy_A 1019 Crystal Structure Of The Alpha-Neurexin-1 Ectodomai 9e-05
3qcw_A 1245 Structure Of Neurexin 1 Alpha (Domains Lns1-Lns6), 1e-04
3r05_A 1254 Structure Of Neurexin 1 Alpha (Domains Lns1-Lns6), 2e-04
>pdb|3POY|A Chain A, Crystal Structure Of The Alpha-Neurexin-1 Ectodomain, Lns 2-6 Length = 1019 Back     alignment and structure

Iteration: 1

Score = 43.9 bits (102), Expect = 9e-05, Method: Composition-based stats. Identities = 23/64 (35%), Positives = 34/64 (53%), Gaps = 3/64 (4%) Query: 126 QQLLERKSTAAPVAAEPRPSGNPCLPSPCGPNSICRVIGNTPACSCVES-YIGRPPNCRP 184 +Q+ E +STA + R + PCL +PC N +CR N C C + Y+GR +C Sbjct: 374 RQMAEVQSTAGVKPSCSRETAKPCLSNPCKNNGMCRDGWNRYVCDCSGTGYLGR--SCER 431 Query: 185 ECTI 188 E T+ Sbjct: 432 EATV 435
>pdb|3QCW|A Chain A, Structure Of Neurexin 1 Alpha (Domains Lns1-Lns6), No Splice Inserts Length = 1245 Back     alignment and structure
>pdb|3R05|A Chain A, Structure Of Neurexin 1 Alpha (Domains Lns1-Lns6), With Splice Insert Ss3 Length = 1254 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query256
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 99.85
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 99.85
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 99.81
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 99.8
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 99.76
2bou_A143 EGF-like module containing mucin-like hormone rece 99.75
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 99.71
4fbr_A267 Lectin, myxobacterial hemagglutinin; beta-barrel, 99.69
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 99.68
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 99.66
2bou_A143 EGF-like module containing mucin-like hormone rece 99.63
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 99.62
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 99.61
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 99.59
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 99.55
4fbr_A267 Lectin, myxobacterial hemagglutinin; beta-barrel, 99.54
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 99.5
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 99.45
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 99.43
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 99.41
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 99.39
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 99.39
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 99.35
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 99.33
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 99.33
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 99.29
1aut_L114 Activated protein C; serine proteinase, plasma cal 99.28
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 99.28
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 99.26
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 99.22
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 99.2
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 99.18
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 99.17
2vh0_B134 Activated factor XA light chain; serine protease, 99.16
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 99.14
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 99.13
3h5c_B 317 Vitamin K-dependent protein Z; protein Z-protein Z 99.13
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 99.1
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 99.08
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 99.07
1aut_L114 Activated protein C; serine proteinase, plasma cal 99.07
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 99.04
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 99.01
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 98.92
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 98.91
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 98.89
2vh0_B134 Activated factor XA light chain; serine protease, 98.87
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 98.8
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 98.78
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 98.77
3h5c_B 317 Vitamin K-dependent protein Z; protein Z-protein Z 98.77
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 98.75
3p5b_L 400 Low density lipoprotein receptor variant; B-propel 98.72
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 98.68
3p5b_L 400 Low density lipoprotein receptor variant; B-propel 98.57
3v65_B 386 Low-density lipoprotein receptor-related protein; 98.54
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 98.5
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 98.37
3v65_B 386 Low-density lipoprotein receptor-related protein; 98.31
2p28_B217 Integrin beta-2; hybrid domain, PSI domain, I-EGF 98.26
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 98.24
2k2s_B61 Micronemal protein 6; microneme protein complex, c 98.23
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 98.17
1egf_A53 Epidermal growth factor; NMR {Mus musculus} SCOP: 98.1
2jkh_L55 Factor X light chain; plasma, calcium, zymogen, se 98.06
2p28_B217 Integrin beta-2; hybrid domain, PSI domain, I-EGF 98.04
3u7u_G55 Neuregulin 1; signaling protein, transferase-trans 98.03
1a3p_A45 Epidermal growth factor; disulfide connectivities, 98.03
2k2s_B61 Micronemal protein 6; microneme protein complex, c 98.02
3u7u_G55 Neuregulin 1; signaling protein, transferase-trans 97.97
2kl7_A71 Fibulin-4; secreted, calcium, disease mutation, di 97.93
1hae_A63 Heregulin-alpha; growth factor; NMR {Homo sapiens} 97.9
1klo_A162 Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: 97.86
1egf_A53 Epidermal growth factor; NMR {Mus musculus} SCOP: 97.85
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 97.73
1a3p_A45 Epidermal growth factor; disulfide connectivities, 97.7
1ob1_C99 Major merozoite surface protein; immune system, im 97.69
1ob1_C99 Major merozoite surface protein; immune system, im 97.69
1hae_A63 Heregulin-alpha; growth factor; NMR {Homo sapiens} 97.64
2kl7_A71 Fibulin-4; secreted, calcium, disease mutation, di 97.6
1kig_L51 Factor XA; glycoprotein, serine protease, plasma, 97.6
1k36_A46 Epiregulin; EGF-like fold, hormone/growth factor c 97.53
3ca7_A52 Protein spitz; argos, EGF, developmental protein, 97.53
1n1i_A105 Merozoite surface protein-1; MSP1, malaria, surfac 97.51
3ca7_A52 Protein spitz; argos, EGF, developmental protein, 97.49
1klo_A162 Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: 97.48
1kli_L69 Factor VIIA; extrinsic coagulation pathway, serine 97.48
2bz6_L53 Blood coagulation factor VIIA; serine protease, en 97.47
1k36_A46 Epiregulin; EGF-like fold, hormone/growth factor c 97.47
1apq_A53 Complement protease C1R; EGF, calcium binding, ser 97.41
1apq_A53 Complement protease C1R; EGF, calcium binding, ser 97.39
1gl4_A 285 Nidogen-1, entactin; immunoglobulin-like domain, e 97.35
2jkh_L55 Factor X light chain; plasma, calcium, zymogen, se 97.35
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 97.33
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 97.26
1g1s_A162 P-selectin; selectin, lectin, EGF, sulphated, SLEX 97.26
1n1i_A105 Merozoite surface protein-1; MSP1, malaria, surfac 97.26
1kli_L69 Factor VIIA; extrinsic coagulation pathway, serine 97.24
1gl4_A285 Nidogen-1, entactin; immunoglobulin-like domain, e 97.23
1nql_B53 Epidermal growth factor; cell surface receptor, ty 97.12
1nql_B53 Epidermal growth factor; cell surface receptor, ty 97.05
1g1s_A162 P-selectin; selectin, lectin, EGF, sulphated, SLEX 96.96
1kig_L51 Factor XA; glycoprotein, serine protease, plasma, 96.71
2bz6_L53 Blood coagulation factor VIIA; serine protease, en 96.51
2wph_E59 Coagulation factor IXA light chain; serine proteas 96.42
3ltf_D58 Protein spitz; receptor-ligand complex ectodomain 96.42
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 96.06
3cfw_A164 L-selectin; EGF, cell adhesion, EGF-like domain, g 96.04
3ltf_D58 Protein spitz; receptor-ligand complex ectodomain 95.84
2wph_E59 Coagulation factor IXA light chain; serine proteas 95.31
3cfw_A164 L-selectin; EGF, cell adhesion, EGF-like domain, g 95.08
2fd6_A122 Urokinase-type plasminogen activator; UPAR, ATF, A 94.96
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 94.43
3e50_C50 Protransforming growth factor alpha; IDE, TGF-alph 94.43
1iox_A50 Betacellulin; EGF-like fold, hormone/growth factor 94.43
1q4g_A 553 Prostaglandin G/H synthase 1; cyclooxygenase, non- 94.37
1szb_A170 Mannose binding lectin-associated serine protease- 94.36
2fd6_A122 Urokinase-type plasminogen activator; UPAR, ATF, A 94.35
1oig_A26 Dumpy, CG33196-PB; structural protein; NMR {Drosop 94.33
1szb_A170 Mannose binding lectin-associated serine protease- 94.21
1oig_A26 Dumpy, CG33196-PB; structural protein; NMR {Drosop 94.17
1q4g_A 553 Prostaglandin G/H synthase 1; cyclooxygenase, non- 94.13
2rnl_A50 Amphiregulin; AR, colorectum cell-derived growth f 93.99
3nt1_A 587 Prostaglandin-endoperoxide synthase 2; prostagland 93.92
3nt1_A 587 Prostaglandin-endoperoxide synthase 2; prostagland 93.71
3e50_C50 Protransforming growth factor alpha; IDE, TGF-alph 93.25
1xdt_R79 Hbegf, heparin-binding epidermal growth factor; co 92.2
1b9w_A95 Protein (merozoite surface protein 1); MSP-1, cand 92.03
1iox_A50 Betacellulin; EGF-like fold, hormone/growth factor 92.0
2ygo_A188 WIF-1, WNT inhibitory factor 1; signaling protein, 91.81
1g1t_A157 E-selectin; EGF, adhesion molecule, SLEX, immune s 91.28
2ygo_A188 WIF-1, WNT inhibitory factor 1; signaling protein, 90.92
1b9w_A95 Protein (merozoite surface protein 1); MSP-1, cand 90.21
2rnl_A50 Amphiregulin; AR, colorectum cell-derived growth f 90.0
1nzi_A159 Complement C1S component; calcium, innate immunity 89.57
2i9a_A145 Urokinase-type plasminogen activator; growth facto 88.47
1g1t_A157 E-selectin; EGF, adhesion molecule, SLEX, immune s 88.39
2y38_A403 Laminin subunit alpha-5; structural protein, cell 88.14
1xdt_R79 Hbegf, heparin-binding epidermal growth factor; co 87.65
1nzi_A159 Complement C1S component; calcium, innate immunity 87.17
3v64_C 349 Agrin; beta propeller, laminin-G, signaling, prote 86.83
2i9a_A145 Urokinase-type plasminogen activator; growth facto 86.04
3asi_A 410 Neurexin-1-alpha; beta-sandwich, cell adhesion, sy 85.52
3asi_A410 Neurexin-1-alpha; beta-sandwich, cell adhesion, sy 85.38
3fby_A 551 COMP, cartilage oligomeric matrix protein; signatu 84.12
3f1s_B283 Vitamin K-dependent protein Z; PZ, ZPI, complex, s 83.38
3ssb_I32 IMPI alpha, inducible metalloproteinase inhibitor 81.62
3v64_C 349 Agrin; beta propeller, laminin-G, signaling, prote 81.62
2e26_A 725 Reelin, reeler protein; signaling protein; HET: NA 80.63
3fby_A 551 COMP, cartilage oligomeric matrix protein; signatu 80.09
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Back     alignment and structure
Probab=99.85  E-value=6.1e-23  Score=160.24  Aligned_cols=146  Identities=19%  Similarity=0.323  Sum_probs=119.8

Q ss_pred             CCCCCCCCeeeeCCCCceeeCCCCCccCCCCCCccccccC----CCCCCCCCceEecC-----CceeeecCCCCcCCCCC
Q psy13151         71 PGSCGAHASCVVLNHTPRCTCDPGFTGDPFSTCFYIQERN----HMVMGSRDQMVLVV-----GQQLLERKSTAAPVAAE  141 (256)
Q Consensus        71 ~~~C~~~~~C~n~~g~~~C~C~~G~~g~~~~~C~~~~~c~----~~~~~~~~~c~~~~-----g~~~c~c~~g~~~~~~~  141 (256)
                      +++|. +++|+++.++|+|.|++||+|.....|+++++|.    ..+|..++.|+++.     ++|.|.|.+||.+... 
T Consensus        10 ~~pC~-ng~C~~~~g~~~C~C~~G~~g~~~~~C~~id~C~~~~~~~~C~~~~~C~~~~~~~~~g~y~C~C~~G~~g~~~-   87 (186)
T 1z1y_A           10 DTICX-NGQLVQMSNHFXCMCNEGLVHLSENTCEEXNECXXETLGXACGEFGQCIENPDPAQVNMYXCGCIEGYTLXED-   87 (186)
T ss_dssp             TCCCB-TEEEEECSSCEEEEECTTEEEEETTEEEECCCCSGGGTTSEEETTEEEEECSSTTSSCSEEEEECTTEEEETT-
T ss_pred             CCCCC-CCEeECCCCCeEeECCCCCccCCCCccCCCCcccCCCCCCCCCCCCEeecCCCCcCCCCEECCCCCCCccCCC-
Confidence            46787 5699999999999999999986444599999998    55677789999999     8999999999987632 


Q ss_pred             CCCCCCCCCCCCCCCCCEEe----ecCCCCeeecCCCccc---CCCCCcccCCcC--CCCCCCCeeeCCcccCCCCCCC-
Q psy13151        142 PRPSGNPCLPSPCGPNSICR----VIGNTPACSCVESYIG---RPPNCRPECTIN--AECAGNLACINERCKDPCPGSC-  211 (256)
Q Consensus       142 ~c~~~~~C~~~~C~~~~~C~----~~~g~~~C~C~~G~~~---~~~~c~~~C~~~--~~C~~~~~C~~~~C~~~C~~~C-  211 (256)
                      .+. +++|...+|.+++.|+    ++.++|+|.|++||+|   ++..    |++.  ++|.               .+| 
T Consensus        88 ~C~-~d~C~~~~C~~~g~C~~~~~~~~g~~~C~C~~Gy~g~~~~~~~----C~~~~~~~C~---------------~~C~  147 (186)
T 1z1y_A           88 TCV-LDVCQYXNCGESGECIVEYLSEIQSAGCSCAIGXVPNPEDEXX----CTXTGETACQ---------------LXCN  147 (186)
T ss_dssp             EEE-EGGGTTCCCCTTEEEEEEEETTEEEEEEEECTEEEEETTTTTE----EEEEECCCCC---------------CCCC
T ss_pred             CCC-CCcCcCCCCCCCCEEeeCCcCCCCCceEECCCCCcccCCCCCc----ceEcCCCccc---------------cccc
Confidence            333 7899988999899998    8888999999999998   3333    3332  3443               358 


Q ss_pred             CCCCeEeeCCCCceeeCCCCCccCCCC
Q psy13151        212 GAHASCVVLNHTPRCTCDPGFTGDPFS  238 (256)
Q Consensus       212 ~~~~~C~~~~g~~~C~C~~G~~g~~~~  238 (256)
                      .++++|+++.++|+|.|++||+|++..
T Consensus       148 ~~~~~C~n~~g~y~C~C~~G~~g~~~~  174 (186)
T 1z1y_A          148 TDNEVCXNVEGVYXCQCMEGFTFDXEX  174 (186)
T ss_dssp             TTTEEEEEETTEEEEEECTTCEEETTT
T ss_pred             ccCcceecCCCCeeeECCCCCccCccc
Confidence            788999999999999999999998654



>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Back     alignment and structure
>4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Back     alignment and structure
>4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Back     alignment and structure
>2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Back     alignment and structure
>1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A Back     alignment and structure
>2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... Back     alignment and structure
>2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A Back     alignment and structure
>3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} Back     alignment and structure
>1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 Back     alignment and structure
>2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A Back     alignment and structure
>3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} Back     alignment and structure
>2kl7_A Fibulin-4; secreted, calcium, disease mutation, disulfide bond, EGF- like domain, glycoprotein, polymorphism, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A Back     alignment and structure
>1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Back     alignment and structure
>1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Back     alignment and structure
>1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 Back     alignment and structure
>1ob1_C Major merozoite surface protein; immune system, immunoglobulin/complex, immunoglobulin, antib fragment, MSP1-19, EGF-like domain; 2.90A {Plasmodium falciparum} SCOP: g.3.11.4 g.3.11.4 PDB: 1cej_A 2flg_A Back     alignment and structure
>1ob1_C Major merozoite surface protein; immune system, immunoglobulin/complex, immunoglobulin, antib fragment, MSP1-19, EGF-like domain; 2.90A {Plasmodium falciparum} SCOP: g.3.11.4 g.3.11.4 PDB: 1cej_A 2flg_A Back     alignment and structure
>1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A Back     alignment and structure
>2kl7_A Fibulin-4; secreted, calcium, disease mutation, disulfide bond, EGF- like domain, glycoprotein, polymorphism, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1 Back     alignment and structure
>1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A Back     alignment and structure
>3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D Back     alignment and structure
>1n1i_A Merozoite surface protein-1; MSP1, malaria, surface antigen, glycoprotein, EGF domain, cell adhesion; HET: HIS; 2.40A {Plasmodium knowlesi strain H} SCOP: g.3.11.4 g.3.11.4 Back     alignment and structure
>3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D Back     alignment and structure
>1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Back     alignment and structure
>1kli_L Factor VIIA; extrinsic coagulation pathway, serine protease activation, R drug design, substrate-assisted catalysis, hydrolase; 1.69A {Homo sapiens} SCOP: g.3.11.1 PDB: 1klj_L 1jbu_L 1ygc_L* Back     alignment and structure
>2bz6_L Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: g.3.11.1 PDB: 1w8b_L* 1w7x_L* 1cvw_L* Back     alignment and structure
>1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A Back     alignment and structure
>1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A Back     alignment and structure
>2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A Back     alignment and structure
>1n1i_A Merozoite surface protein-1; MSP1, malaria, surface antigen, glycoprotein, EGF domain, cell adhesion; HET: HIS; 2.40A {Plasmodium knowlesi strain H} SCOP: g.3.11.4 g.3.11.4 Back     alignment and structure
>1kli_L Factor VIIA; extrinsic coagulation pathway, serine protease activation, R drug design, substrate-assisted catalysis, hydrolase; 1.69A {Homo sapiens} SCOP: g.3.11.1 PDB: 1klj_L 1jbu_L 1ygc_L* Back     alignment and structure
>1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A Back     alignment and structure
>1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* Back     alignment and structure
>1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* Back     alignment and structure
>1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A Back     alignment and structure
>1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1 Back     alignment and structure
>2bz6_L Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: g.3.11.1 PDB: 1w8b_L* 1w7x_L* 1cvw_L* Back     alignment and structure
>2wph_E Coagulation factor IXA light chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpi_E* 2wpj_E* 2wpk_E* 2wpl_E* 2wpm_E 3kcg_L* 3lc3_B* 1rfn_B* 3lc5_B* Back     alignment and structure
>3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster} Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster} Back     alignment and structure
>2wph_E Coagulation factor IXA light chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpi_E* 2wpj_E* 2wpk_E* 2wpl_E* 2wpm_E 3kcg_L* 3lc3_B* 1rfn_B* 3lc5_B* Back     alignment and structure
>2fd6_A Urokinase-type plasminogen activator; UPAR, ATF, ATN-615 antibody, FAB, ternary complex, immune SY hydrolase; HET: PGE NAG FUC NDG PG4; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 3bt2_A* 3bt1_A* 3u73_A* 1urk_A* 3laq_A* 1kdu_A Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3e50_C Protransforming growth factor alpha; IDE, TGF-alpha, cytoplasm, hydrolase, metal-binding, metalloprotease, polymorphism, protease, zinc; 2.30A {Homo sapiens} SCOP: g.3.11.1 PDB: 1yuf_A 1yug_A 2tgf_A 1mox_C 3tgf_A 4tgf_A Back     alignment and structure
>1iox_A Betacellulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1ip0_A Back     alignment and structure
>1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ... Back     alignment and structure
>1szb_A Mannose binding lectin-associated serine protease-2 related protein, MAP19 (19KDA)...; calcium, complement, innate immunity, CUB, EGF; 2.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Back     alignment and structure
>2fd6_A Urokinase-type plasminogen activator; UPAR, ATF, ATN-615 antibody, FAB, ternary complex, immune SY hydrolase; HET: PGE NAG FUC NDG PG4; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 3bt2_A* 3bt1_A* 3u73_A* 1urk_A* 3laq_A* 1kdu_A Back     alignment and structure
>1szb_A Mannose binding lectin-associated serine protease-2 related protein, MAP19 (19KDA)...; calcium, complement, innate immunity, CUB, EGF; 2.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Back     alignment and structure
>1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ... Back     alignment and structure
>2rnl_A Amphiregulin; AR, colorectum cell-derived growth factor, EGF-like domain, CRDGF, cytokine, glycoprotein, membrane, polymorphism, transmembrane; NMR {Homo sapiens} Back     alignment and structure
>3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 4fm5_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* ... Back     alignment and structure
>3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 4fm5_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* ... Back     alignment and structure
>3e50_C Protransforming growth factor alpha; IDE, TGF-alpha, cytoplasm, hydrolase, metal-binding, metalloprotease, polymorphism, protease, zinc; 2.30A {Homo sapiens} SCOP: g.3.11.1 PDB: 1yuf_A 1yug_A 2tgf_A 1mox_C 3tgf_A 4tgf_A Back     alignment and structure
>1xdt_R Hbegf, heparin-binding epidermal growth factor; complex (toxin-growth factor), diphtheria toxin, receptor, H binding epidermal growth factor; 2.65A {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>1b9w_A Protein (merozoite surface protein 1); MSP-1, candidate malaria vaccine, surface antigen; 1.80A {Plasmodium cynomolgi} SCOP: g.3.11.4 g.3.11.4 PDB: 2npr_A Back     alignment and structure
>1iox_A Betacellulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1ip0_A Back     alignment and structure
>2ygo_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: MLY PCF NAG; 1.85A {Homo sapiens} PDB: 2ygp_A* Back     alignment and structure
>1g1t_A E-selectin; EGF, adhesion molecule, SLEX, immune system, membrane protein; HET: SIA GAL MAG FUC; 1.50A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1esl_A Back     alignment and structure
>2ygo_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: MLY PCF NAG; 1.85A {Homo sapiens} PDB: 2ygp_A* Back     alignment and structure
>1b9w_A Protein (merozoite surface protein 1); MSP-1, candidate malaria vaccine, surface antigen; 1.80A {Plasmodium cynomolgi} SCOP: g.3.11.4 g.3.11.4 PDB: 2npr_A Back     alignment and structure
>2rnl_A Amphiregulin; AR, colorectum cell-derived growth factor, EGF-like domain, CRDGF, cytokine, glycoprotein, membrane, polymorphism, transmembrane; NMR {Homo sapiens} Back     alignment and structure
>1nzi_A Complement C1S component; calcium, innate immunity, modular structure, CUB, EGF, hydrolase; 1.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Back     alignment and structure
>2i9a_A Urokinase-type plasminogen activator; growth factor-like domain, kringle domain, hydrolase; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 2i9b_A* Back     alignment and structure
>1g1t_A E-selectin; EGF, adhesion molecule, SLEX, immune system, membrane protein; HET: SIA GAL MAG FUC; 1.50A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1esl_A Back     alignment and structure
>2y38_A Laminin subunit alpha-5; structural protein, cell adhesion, basement membrane; HET: NAG; 2.90A {Mus musculus} Back     alignment and structure
>1xdt_R Hbegf, heparin-binding epidermal growth factor; complex (toxin-growth factor), diphtheria toxin, receptor, H binding epidermal growth factor; 2.65A {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>1nzi_A Complement C1S component; calcium, innate immunity, modular structure, CUB, EGF, hydrolase; 1.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>2i9a_A Urokinase-type plasminogen activator; growth factor-like domain, kringle domain, hydrolase; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 2i9b_A* Back     alignment and structure
>3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} Back     alignment and structure
>3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} Back     alignment and structure
>3fby_A COMP, cartilage oligomeric matrix protein; signature domain, cell adhesion, disease mutation, dwarfism, EGF-like domain, glycoprotein, secreted; HET: NAG MAN; 3.15A {Homo sapiens} Back     alignment and structure
>3f1s_B Vitamin K-dependent protein Z; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} Back     alignment and structure
>3ssb_I IMPI alpha, inducible metalloproteinase inhibitor protein; thermolysin fold - family I8 fold, metalloprotease thermoLys inhibitor; 1.80A {Galleria mellonella} Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>2e26_A Reelin, reeler protein; signaling protein; HET: NAG BMA; 2.00A {Mus musculus} PDB: 3a7q_A* Back     alignment and structure
>3fby_A COMP, cartilage oligomeric matrix protein; signature domain, cell adhesion, disease mutation, dwarfism, EGF-like domain, glycoprotein, secreted; HET: NAG MAN; 3.15A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query256
d1emoa143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.73
d2vj3a142 Neurogenic locus notch homolog protein 1, Notch1 { 98.7
d2vj3a142 Neurogenic locus notch homolog protein 1, Notch1 { 98.66
d1gl4a240 EGF-like domain of nidogen-1 {Mouse (Mus musculus) 98.64
d1emoa143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.63
d1edmb_39 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 98.62
d2c4fl137 Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} 98.57
d2vj3a239 Neurogenic locus notch homolog protein 1, Notch1 { 98.56
d2vj3a239 Neurogenic locus notch homolog protein 1, Notch1 { 98.52
d2vj3a335 Neurogenic locus notch homolog protein 1, Notch1 { 98.48
d1edmb_39 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 98.46
d1gl4a240 EGF-like domain of nidogen-1 {Mouse (Mus musculus) 98.43
d1xkba139 Factor X, N-terminal module {Human (Homo sapiens) 98.4
d1lmja242 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.37
d2vj3a335 Neurogenic locus notch homolog protein 1, Notch1 { 98.37
d2c4fl137 Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} 98.36
d1lmja144 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.33
d1xkba139 Factor X, N-terminal module {Human (Homo sapiens) 98.33
d1lmja144 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.32
d1g1sa240 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 98.27
d1g1sa240 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 98.24
d1i0ua241 Low density lipoprotein (LDL) receptor, different 98.22
d1uzka243 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.17
d1uzka143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.16
d1uzka143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.16
d1g1ta239 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 98.15
d1lmja242 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.13
d1apqa_53 Complement protease C1R {Human (Homo sapiens) [Tax 98.05
d1uzka243 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.05
d1tpga141 Plasminogen activator (tissue-type), t-PA {Human ( 98.03
d1g1ta239 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 98.03
d1dx5i340 Thrombomodulin, different EGF-like domains {Human 98.03
d1apqa_53 Complement protease C1R {Human (Homo sapiens) [Tax 98.01
d1i0ua241 Low density lipoprotein (LDL) receptor, different 98.0
d1nt0a345 Mannose-binding protein associated serine protease 97.97
d1dx5i340 Thrombomodulin, different EGF-like domains {Human 97.97
d1szba245 Mannose-binding protein associated serine protease 97.92
d1autl148 Activated protein c (autoprothrombin IIa) {Human ( 97.9
d1autl148 Activated protein c (autoprothrombin IIa) {Human ( 97.87
d1tpga141 Plasminogen activator (tissue-type), t-PA {Human ( 97.76
d1q4ga242 Prostaglandin H2 synthase-1, EGF-like module {Shee 97.75
d1cvua241 Prostaglandin H2 synthase-1, EGF-like module {Mous 97.74
d1q4ga242 Prostaglandin H2 synthase-1, EGF-like module {Shee 97.71
d1cvua241 Prostaglandin H2 synthase-1, EGF-like module {Mous 97.59
d3bpse140 Low density lipoprotein (LDL) receptor, different 97.57
d1szba245 Mannose-binding protein associated serine protease 97.51
d1nzia242 Complement C1S component {Human (Homo sapiens) [Ta 97.45
d1haea_63 Heregulin-alpha, EGF-like domain {Human (Homo sapi 97.44
d3bpse140 Low density lipoprotein (LDL) receptor, different 97.42
d1nt0a345 Mannose-binding protein associated serine protease 97.4
d3egfa_53 Epidermal growth factor, EGF {Mouse (Mus musculus) 97.37
d3egfa_53 Epidermal growth factor, EGF {Mouse (Mus musculus) 97.29
d1emoa239 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 97.22
d1nzia242 Complement C1S component {Human (Homo sapiens) [Ta 97.2
d1haea_63 Heregulin-alpha, EGF-like domain {Human (Homo sapi 97.07
d1emoa239 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 97.0
d1nqlb_48 Epidermal growth factor, EGF {Human (Homo sapiens) 96.99
d1nqlb_48 Epidermal growth factor, EGF {Human (Homo sapiens) 96.93
d1kigl_51 Factor X, N-terminal module {Cow (Bos taurus) [Tax 96.88
d1autl250 Activated protein c (autoprothrombin IIa) {Human ( 96.76
d2p3ua151 Factor X, N-terminal module {Human (Homo sapiens) 96.62
d1k36a_46 Epiregulin, EGF-domain {Human (Homo sapiens) [TaxI 95.95
d1ioxa_50 Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606] 95.78
d1moxc_49 Transforming growth factor alpha {Human (Homo sapi 95.7
d1kigl_51 Factor X, N-terminal module {Cow (Bos taurus) [Tax 95.7
d1autl250 Activated protein c (autoprothrombin IIa) {Human ( 95.62
d2p3ua151 Factor X, N-terminal module {Human (Homo sapiens) 95.14
d1ioxa_50 Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606] 94.74
d1rfnb_57 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 94.45
d1k36a_46 Epiregulin, EGF-domain {Human (Homo sapiens) [TaxI 94.19
d1moxc_49 Transforming growth factor alpha {Human (Homo sapi 94.16
d2i9aa140 Plasminogen activator (urokinase-type) {Human (Hom 93.71
d1xdtr_41 Heparin-binding epidermal growth factor, HBEGF {Hu 93.29
d1ijqa250 Low density lipoprotein (LDL) receptor, different 93.07
d1ijqa250 Low density lipoprotein (LDL) receptor, different 90.87
d2bz6l153 Coagulation factor VIIa {Human (Homo sapiens) [Tax 90.47
d2i9aa140 Plasminogen activator (urokinase-type) {Human (Hom 90.4
d1rfnb_57 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 90.05
d1dx5i235 Thrombomodulin, different EGF-like domains {Human 89.81
d1xdtr_41 Heparin-binding epidermal growth factor, HBEGF {Hu 88.39
d1dx5i143 Thrombomodulin, different EGF-like domains {Human 88.13
d1jv2b431 Integrin beta EGF-like domains {Human (Homo sapien 86.22
d1kloa155 Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 84.72
d2bz6l153 Coagulation factor VIIa {Human (Homo sapiens) [Tax 84.4
d1oiga_26 Dumpy {Fruit fly (Drosophila melanogaster) [TaxId: 83.19
d1l3ya_41 Integrin beta EGF-like domains {Human (Homo sapien 81.12
>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: Knottins (small inhibitors, toxins, lectins)
superfamily: EGF/Laminin
family: EGF-type module
domain: Fibrillin-1
species: Human (Homo sapiens) [TaxId: 9606]
Probab=98.73  E-value=2.6e-09  Score=60.03  Aligned_cols=40  Identities=18%  Similarity=0.345  Sum_probs=32.8

Q ss_pred             CCCCCCCCCCCCCCCCEEeecCCCCeeecCCCcccCCCCC
Q psy13151        143 RPSGNPCLPSPCGPNSICRVIGNTPACSCVESYIGRPPNC  182 (256)
Q Consensus       143 c~~~~~C~~~~C~~~~~C~~~~g~~~C~C~~G~~~~~~~c  182 (256)
                      |.|||||...++..+++|+|++|+|.|.|++||++++..|
T Consensus         2 CvDidEC~~~~~~~~~~C~Nt~Gsy~C~C~~Gy~~~g~~C   41 (43)
T d1emoa1           2 AVDMDECKEPDVCKHGQCINTDGSYRCECPFGYILAGNEC   41 (43)
T ss_dssp             CCCCCSSSSTTSCSSSCCCCCSSCCCCCCCTTEEESSSCE
T ss_pred             CcceeccCCcCCCCCCEeECCCCCeEeECCCCcccCCCcc
Confidence            6789999865555678999999999999999999875443



>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1emoa2 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1emoa2 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rfnb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i9aa1 g.3.11.1 (A:10-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xdtr_ g.3.11.1 (R:) Heparin-binding epidermal growth factor, HBEGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ijqa2 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ijqa2 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bz6l1 g.3.11.1 (L:90-142) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i9aa1 g.3.11.1 (A:10-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rfnb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dx5i2 g.3.11.1 (I:388-422) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xdtr_ g.3.11.1 (R:) Heparin-binding epidermal growth factor, HBEGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dx5i1 g.3.11.1 (I:345-387) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jv2b4 g.3.11.6 (B:532-562) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kloa1 g.3.11.2 (A:11-65) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bz6l1 g.3.11.1 (L:90-142) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oiga_ g.3.18.1 (A:) Dumpy {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1l3ya_ g.3.11.6 (A:) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure