Diaphorina citri psyllid: psy13159


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660
MIDYITYCAFTASSGNTWKNIRFKNAPPPPQQDVQEYVNPCVPSPCGPYSQCRDIGGSPSCSCLPNYIGAPPNCRPECLQNSECPNDKACIREKCADPCPGSCGYNAQCKVINHTPICTCPDGFIGDAFLSCHPKPPEPVQPIIQEDTCNCVPNAECRDGVCVCLPDYYGDGYVSCRPECVVNSECPRNKACIKYKCKNPCVPGTCGEGAICDVVNHAVVCTCPPGTTGSPLVLCRPIQNEPVYTNPCQPSPCGPNSQCREVNKQAVCSCLPNYFGSPPNCRPECTVNTDCPLNKACVNQKCVDPCPGSCGENRELDAQRFLVSSVCLPDYYGDGYVSCRPECVLNSDCPSNKACIRNKCKNPCVPGTCGEGAICDVFLLSFTAPPPPLESPPEYVNPCIPSPCGPYSQCRDIGGSPSCSCLPNYIGSPPNCRPECVMNSECPSNEACINEKCGDPCPGSCGYNAQCKVINHTPICTCPDGFIGDPFTLCSPKPPEPRPPPQEDVPEPVNPCYPSPCGPYSQCRDIGGSPSCSCLPNYIGAPPNCRPECVQNNDCSNDKACINEKCQDPCPGSCGYNALCKVINHTPICTCPDGYTGDAFSGCYPKPPEQQQLKRDRGGILVLLPITRRKIKYECRCRRRRGRKRSTSTNCLSLPYAHIF
ccccccccccccccccccccEEEEccccccccccccccccccccccccccEEEcccccEEEEcccccccccccccccccccccccccccccccccccccccccccccEEEEcccccEEccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccEEECccccEEEEcccccccccccccccccccccccccccccccccccEEccccccEEEEcccccccccccccccccccccccccccccccccccccccccccccCCcccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccccccEEccccccccccccccccccccccccEEEccccccEEEccccccccccccccccccccccccccEEEccccccccccccccccCECcccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccEEEEccccccccccccccccccccccccccEEEccccccccccccccccEEECcccccEEEccccccccccccccccccccccccccccccccccccccccccEEEEcccccccccccccccccccccccc
MIDYITYCAFTASSGNTWKNIRFKNAPPPPQQDVQEYVNPCVPSPCGPYSQCRDIGGSPSCSCLPNYIGAPPNCRPECLQNSECPNDKACIREKCADPCPGSCGYNAQCKVINHTPICTCPDGFIGDAFLSCHPKPPEPVQPIIQEDTCNCVPNAECRDGVCVCLPDYYGDGYVSCRPECVVNSECPRNKACIKYKCKNPCVPGTCGEGAICDVVNHAVVCTCPPGTTGSPLVLCRPIQNEPVYTNPCQPSPCGPNSQCREVNKQAVCSCLPNYFGSPPNCRPECTVNTDCPLNKACVNQKCVDPCPGSCGENRELDAQRFLVSSVCLPDYYGDGYVSCRPECVLNSDCPSNKACIRNKCKNPCVPGTCGEGAICDVFLLSFTAPPPPLESPPEYVNPCIPSPCGPYSQCRDIGGSPSCSCLPNYIGSPPNCRPECVMNSECPSNEACINEKCGDPCPGSCGYNAQCKVINHTPICTCPDGFIGDPFTLCSPKPPEPRPPPQEDVPEPVNPCYPSPCGPYSQCRDIGGSPSCSCLPNYIGAPPNCRPECVQNNDCSNDKACINEKCQDPCPGSCGYNALCKVINHTPICTCPDGYTGDAFSGCYPKPPEQQQLKRDRGGILVLLPITRRKIKYECRCRRRRGRKRSTSTNCLSLPYAHIF
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIDYITYCAFTASSGNTWKNIRFKNAPPPPQQDVQEYVNPCVPSPCGPYSQCRDIGGSPSCSCLPNYIGAPPNCRPECLQNSECPNDKACIREKCADPCPGSCGYNAQCKVINHTPICTCPDGFIGDAFLSCHPKPPEPVQPIIQEDTCNCVPNAECRDGVCVCLPDYYGDGYVSCRPECVVNSECPRNKACIKYKCKNPCVPGTCGEGAICDVVNHAVVCTCPPGTTGSPLVLCRPIQNEPVYTNPCQPSPCGPNSQCREVNKQAVCSCLPNYFGSPPNCRPECTVNTDCPLNKACVNQKCVDPCPGSCGENRELDAQRFLVSSVCLPDYYGDGYVSCRPECVLNSDCPSNKACIRNKCKNPCVPGTCGEGAICDVFLLSFTAPPPPLESPPEYVNPCIPSPCGPYSQCRDIGGSPSCSCLPNYIGSPPNCRPECVMNSECPSNEACINEKCGDPCPGSCGYNAQCKVINHTPICTCPDGFIGDPFTLCSPKPPEPRPPPQEDVPEPVNPCYPSPCGPYSQCRDIGGSPSCSCLPNYIGAPPNCRPECVQNNDCSNDKACINEKCQDPCPGSCGYNALCKVINHTPICTCPDGYTGDAFSGCYPKPPEQQQLKRDRGGILVLLPITRRKIKYECRCRRRRGRKRSTSTNCLSLPYAHIF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0046331 [BP]lateral inhibitionprobableGO:0032502, GO:0044700, GO:0045165, GO:0048869, GO:0030154, GO:0045168, GO:0008150, GO:0044763, GO:0023052, GO:0007267, GO:0007154, GO:0009987, GO:0044699
GO:0008362 [BP]chitin-based embryonic cuticle biosynthetic processprobableGO:0032502, GO:0040003, GO:0042335, GO:0044707, GO:0048856, GO:0044767, GO:0032501, GO:0008150, GO:0007275, GO:0044699
GO:0007475 [BP]apposition of dorsal and ventral imaginal disc-derived wing surfacesprobableGO:0048563, GO:0048569, GO:0008587, GO:0009887, GO:0035220, GO:0009791, GO:0035120, GO:0002165, GO:0032501, GO:0009653, GO:0007275, GO:0044699, GO:0007472, GO:0007552, GO:0007476, GO:0048513, GO:0032502, GO:0048707, GO:0009886, GO:0035107, GO:0035114, GO:0008150, GO:0044767, GO:0044707, GO:0007444, GO:0048856, GO:0007560, GO:0048731, GO:0048736, GO:0048737
GO:0007424 [BP]open tracheal system developmentprobableGO:0060541, GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0040005 [BP]chitin-based cuticle attachment to epitheliumprobableGO:0032501, GO:0044707, GO:0007591, GO:0022404, GO:0008150, GO:0042303, GO:0044699

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3K6S, chain B
Confidence level:very confident
Coverage over the Query: 43-130,144-183,198-235,246-260
View the alignment between query and template
View the model in PyMOL
Template: 1UZK, chain A
Confidence level:very confident
Coverage over the Query: 394-445,458-488,517-558,571-600
View the alignment between query and template
View the model in PyMOL
Template: 1UZK, chain A
Confidence level:very confident
Coverage over the Query: 36-87,100-133,153-189,203-231
View the alignment between query and template
View the model in PyMOL
Template: 3K6S, chain B
Confidence level:very confident
Coverage over the Query: 100-183,202-277
View the alignment between query and template
View the model in PyMOL
Template: 2BOU, chain A
Confidence level:very confident
Coverage over the Query: 402-444,460-555
View the alignment between query and template
View the model in PyMOL
Template: 2YGQ, chain A
Confidence level:confident
Coverage over the Query: 43-86,97-131,147-175,199-233,245-244
View the alignment between query and template
View the model in PyMOL
Template: 3FCS, chain B
Confidence level:confident
Coverage over the Query: 398-446,457-488,507-559,571-652
View the alignment between query and template
View the model in PyMOL
Template: 4FBR, chain A
Confidence level:confident
Coverage over the Query: 258-294,308-346,362-377,389-468,483-488,507-559,574-601,613-644
View the alignment between query and template
View the model in PyMOL
Template: 3T5O, chain A
Confidence level:probable
Coverage over the Query: 153-287,299-373,390-582
View the alignment between query and template
View the model in PyMOL