Diaphorina citri psyllid: psy13160


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180------
MFTAYLPPYPSNDSLACKPNPCDPYSSCSVYSEHVAMCDPCSGPQAPWLPHCRPECLCNSDCPFNMAFPEGDECSPNPCGPYTGCRVVSGSAVCFCLPEYTGDPPSVPCTLPLNPCHNSPCGPNTQCSLLDNGFAQCTCLPGYVESPNTIRGCVERRQPCEPNVCGAGAVCDPNRAPYCFCPEGTM
ccccccccccccccccccccccccccCEEEccccEEEEcccccccccccccccccEEEcccccccccccccccccccccccccEEEEEcccCEEEccccccccccccccccccccccccccccccEEEcccccCEEEECccccccccccccccccccccccccccccccEEccccccEEEcccccc
MFTAYLPPYPSNDSLACKPNPCDPYSSCSVYSEHVAMCDPCSGPQAPWLPHCRPECLCNSDCPFNMAFPEGDECSPNPCGPYTGCRVVSGSAVCFCLPEYTGDPPSVPCTLPLNPCHNSPCGPNTQCSLLDNGFAQCTCLPGYVESPNTIRGCVERRQPCEPNVCGAGAVCDPNRAPYCFCPEGTM
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFTAYLPPYPSNDSLACKPNPCDPYSSCSVYSEHVAMCDPCSGPQAPWLPHCRPECLCNSDCPFNMAFPEGDECSPNPCGPYTGCRVVSGSAVCFCLPEYTGDPPSVPCTLPLNPCHNSPCGPNTQCSLLDNGFAQCTCLPGYVESPNTIRGCVERRQPCEPNVCGAGAVCDPNRAPYCFCPEGTM

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0046331 [BP]lateral inhibitionprobableGO:0032502, GO:0044700, GO:0045165, GO:0048869, GO:0030154, GO:0045168, GO:0008150, GO:0044763, GO:0023052, GO:0007267, GO:0007154, GO:0009987, GO:0044699
GO:0008362 [BP]chitin-based embryonic cuticle biosynthetic processprobableGO:0032502, GO:0040003, GO:0042335, GO:0044707, GO:0048856, GO:0044767, GO:0032501, GO:0008150, GO:0007275, GO:0044699
GO:0007475 [BP]apposition of dorsal and ventral imaginal disc-derived wing surfacesprobableGO:0048563, GO:0048569, GO:0008587, GO:0009887, GO:0035220, GO:0009791, GO:0035120, GO:0002165, GO:0032501, GO:0009653, GO:0007275, GO:0044699, GO:0007472, GO:0007552, GO:0007476, GO:0048513, GO:0032502, GO:0048707, GO:0009886, GO:0035107, GO:0035114, GO:0008150, GO:0044767, GO:0044707, GO:0007444, GO:0048856, GO:0007560, GO:0048731, GO:0048736, GO:0048737
GO:0007424 [BP]open tracheal system developmentprobableGO:0060541, GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0040005 [BP]chitin-based cuticle attachment to epitheliumprobableGO:0032501, GO:0044707, GO:0007591, GO:0022404, GO:0008150, GO:0042303, GO:0044699
GO:2000026 [BP]regulation of multicellular organismal developmentprobableGO:0050793, GO:0008150, GO:0065007, GO:0050789, GO:0051239
GO:0006355 [BP]regulation of transcription, DNA-dependentprobableGO:0009889, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:2000112, GO:0050794, GO:0050789, GO:0019219, GO:0010556, GO:0065007, GO:0051171, GO:2001141, GO:0008150, GO:0010468
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0004867 [MF]serine-type endopeptidase inhibitor activityprobableGO:0004866, GO:0030234, GO:0061134, GO:0003674, GO:0030414, GO:0004857, GO:0061135
GO:0004519 [MF]endonuclease activityprobableGO:0004518, GO:0016787, GO:0003674, GO:0016788, GO:0003824
GO:0005201 [MF]extracellular matrix structural constituentprobableGO:0003674, GO:0005198
GO:0048583 [BP]regulation of response to stimulusprobableGO:0008150, GO:0065007, GO:0050789
GO:0051539 [MF]4 iron, 4 sulfur cluster bindingprobableGO:0051536, GO:0003674, GO:0051540, GO:0005488
GO:0048522 [BP]positive regulation of cellular processprobableGO:0048518, GO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0044459 [CC]plasma membrane partprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425
GO:0045596 [BP]negative regulation of cell differentiationprobableGO:0051093, GO:0050793, GO:0050794, GO:0008150, GO:0045595, GO:0065007, GO:0048519, GO:0050789, GO:0048523
GO:0005509 [MF]calcium ion bindingprobableGO:0043169, GO:0046872, GO:0003674, GO:0005488, GO:0043167
GO:0043234 [CC]protein complexprobableGO:0005575, GO:0032991
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0009986 [CC]cell surfaceprobableGO:0005575, GO:0044464, GO:0005623
GO:0048699 [BP]generation of neuronsprobableGO:0032502, GO:0048856, GO:0044707, GO:0007399, GO:0009987, GO:0048869, GO:0030154, GO:0008150, GO:0032501, GO:0044763, GO:0048731, GO:0022008, GO:0007275, GO:0044699
GO:0005578 [CC]proteinaceous extracellular matrixprobableGO:0005575, GO:0005576, GO:0044421, GO:0031012
GO:0005615 [CC]extracellular spaceprobableGO:0005575, GO:0005576, GO:0044421
GO:0010033 [BP]response to organic substanceprobableGO:0042221, GO:0050896, GO:0008150
GO:0043229 [CC]intracellular organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0043226
GO:0009719 [BP]response to endogenous stimulusprobableGO:0050896, GO:0008150

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2VJ3, chain A
Confidence level:very confident
Coverage over the Query: 12-38,59-158
View the alignment between query and template
View the model in PyMOL
Template: 2VJ3, chain A
Confidence level:very confident
Coverage over the Query: 70-186
View the alignment between query and template
View the model in PyMOL
Template: 2YGQ, chain A
Confidence level:confident
Coverage over the Query: 16-112
View the alignment between query and template
View the model in PyMOL