Diaphorina citri psyllid: psy13180

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320------

GITGGIEICITFPTEYVKTQLQLDGKGADKKYTGIWDCAKKTVKSHGLYLQEVSRALQLDGKGADKKYTGIWDCAKKTVKSHGFKGVYQGLSATILKQGSNQAIRFFVMETMKDVYRGGDSTAHVPKYMVGVFGAVAGAASVFGNTPLDVVKTRMQGLEAARYKNTLDCAVQIWKHEGPAAFYKGTVPRLGRVCLDVAITFMIYDSFMEVFNKSKNIESCIDLLDLWFEYFRFGAFEQLKNQAVDSQGNLSPGMRVLCGLGAGICEAIFAVTPMETVKVKFINDQRSPNPRFKGFFHGTGLIIKEEGKVALTLVIEEKECFQHINK

ccccHHHHHHcccHHHHHHHHHcccccccccccccccccccccccccccHHHHHHHHHccccccccccccHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHccccccccccHHHHHHHHHHHcccccccccccccHHHHHcccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHcccccccccccccHHHHHHHHHHHHcHHHHccccHHHHHHHHccc

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Tricarboxylate transport protein, mitochondrial	Involved in citrate-H(+)/malate exchange. Important for the bioenergetics of hepatic cells as it provides a carbon source for fatty acid and sterol biosyntheses, and NAD(+) for the glycolytic pathway.	confident	P79110
Tricarboxylate transport protein, mitochondrial	Involved in citrate-H(+)/malate exchange. Important for the bioenergetics of hepatic cells as it provides a carbon source for fatty acid and sterol biosyntheses, and NAD(+) for the glycolytic pathway.	confident	P53007
Tricarboxylate transport protein, mitochondrial	Involved in citrate-H(+)/malate exchange. Important for the bioenergetics of hepatic cells as it provides a carbon source for fatty acid and sterol biosyntheses, and NAD(+) for the glycolytic pathway.	confident	P32089

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0006843 [BP]	mitochondrial citrate transport	probable	GO:0006842, GO:0051234, GO:0006820, GO:0071702, GO:0046907, GO:0015849, GO:0006811, GO:0006810, GO:0044763, GO:0015711, GO:0044765, GO:0008150, GO:0051649, GO:0006839, GO:0015746, GO:0009987, GO:0051641, GO:0051179, GO:0044699, GO:0046942
GO:0005811 [CC]	lipid particle	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0016006 [CC]	Nebenkern	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005739, GO:0005622, GO:0005575, GO:0044444, GO:0005623, GO:0044424, GO:0043227, GO:0043226
GO:0015142 [MF]	tricarboxylic acid transmembrane transporter activity	probable	GO:0022891, GO:0022892, GO:0005342, GO:0008514, GO:0005215, GO:0008509, GO:0015075, GO:0022857, GO:0003674, GO:0046943
GO:0005886 [CC]	plasma membrane	probable	GO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2LCK, chain A
Confidence level:very confident
Coverage over the Query: 1-31,61-215,247-323
View the alignment between query and template
View the model in PyMOL