Diaphorina citri psyllid: psy13183


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190--
TFDSKEDFDKKIKVLSEWIDKAKHVVLHTGAGISTSAGIPDFRGPNGVWTLEKKGIKPKVNISFDDAVPTVTHMAILELVNQGKVHYVVSQNIDGLHLRSGLSRKYLAELHGNMYVDQCNKCERQFVRKSATNSVGQKNLNIPCPYRGFRPCRGTLHDTILDWEHNLPQKDINMGDYNSSIADLSIIESKRG
ccccHHHHHHHHHHHHHHHHHcccEEEEEccccccccccccccccccccccccccccccccEEcccccccHHHHHHHHHHHcccccEEEEcccccHHHHcccccccEEEEcccccccccccccccccHHHHHHHccccccccccccccccccccEEcccEEEccccccHHHHHHHHHHHHHccEEEEEcccc
*FDSKEDFDKKIKVLSEWIDKAKHVVLHTGAGISTSAGIPDFRGPNGVWTLEKKGIKPKVNISFDDAVPTVTHMAILELVNQGKVHYVVSQNIDGLHLRSGLSRKYLAELHGNMYVDQCNKCERQFVRKSATNSVGQKNLNIPCPYRGFRPCRGTLHDTILDWEHNLPQKDINMGDYNSSIADLSIIESKRG
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
TFDSKEDFDKKIKVLSEWIDKAKHVVLHTGAGISTSAGIPDFRGPNGVWTLEKKGIKPKVNISFDDAVPTVTHMAILELVNQGKVHYVVSQNIDGLHLRSGLSRKYLAELHGNMYVDQCNKCERQFVRKSATNSVGQKNLNIPCPYRGFRPCRGTLHDTILDWEHNLPQKDINMGDYNSSIADLSIIESKRG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
NAD-dependent protein deacetylase NAD-dependent protein deacetylase which modulates the activities of several enzymes which are inactive in their acetylated form.confidentQ73KE1
NAD-dependent protein deacylase NAD-dependent protein deacetylase which modulates the activities of several enzymes which are inactive in their acetylated form. Deacetylates the N-terminal lysine residue of Alba, the major archaeal chromatin protein and that, in turn, increases Alba's DNA binding affinity, thereby repressing transcription. May also have NAD-dependent lysine demalonylase and desuccinylase activity.confidentO58669
NAD-dependent protein deacetylase sirtuin-6 NAD-dependent protein deacetylase. Has deacetylase activity towards histone H3K9Ac and H3K56Ac. Modulates acetylation of histone H3 in telomeric chromatin during the S-phase of the cell cycle. Deacetylates histone H3K9Ac at NF-kappa-B target promoters and may down-regulate the expression of a subset of NF-kappa-B target genes. Acts as a corepressor of the transcription factor HIF1A to control the expression of multiple glycolytic genes to regulate glucose homeostasis. Required for genomic stability. Regulates the production of TNF protein. Has a role in the regulation of life span (By similarity). Deacetylation of nucleosomes interferes with RELA binding to target DNA. May be required for the association of WRN with telomeres during S-phase and for normal telomere maintenance. Required for genomic stability. Required for normal IGF1 serum levels and normal glucose homeostasis. Modulates cellular senescence and apoptosis. On DNA damage, promotes DNA end resection via deacetylation of RBBP8. Has very weak deacetylase activity and can bind NAD(+) in the absence of acetylated substrate.confidentQ8N6T7

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0070932 [BP]histone H3 deacetylationprobableGO:0006476, GO:0044699, GO:0044267, GO:0044260, GO:0006325, GO:0071840, GO:0016043, GO:0016575, GO:0071704, GO:0016570, GO:0035601, GO:0009987, GO:0006464, GO:0043412, GO:0036211, GO:0044763, GO:0008152, GO:0006996, GO:0044238, GO:0051276, GO:0019538, GO:0044237, GO:0043170, GO:0008150, GO:0016568, GO:0016569
GO:0005654 [CC]nucleoplasmprobableGO:0005575, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0000122 [BP]negative regulation of transcription from RNA polymerase II promoterprobableGO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0010629, GO:0050789, GO:0010605, GO:0019222, GO:2000112, GO:2000113, GO:0060255, GO:0006357, GO:0065007, GO:0048519, GO:0010468, GO:0045934, GO:0019219, GO:0009889, GO:0050794, GO:0045892, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0008150, GO:0010558, GO:0048523
GO:0046969 [MF]NAD-dependent histone deacetylase activity (H3-K9 specific)probableGO:0016787, GO:0019213, GO:0003824, GO:0004407, GO:0016810, GO:0016811, GO:0017136, GO:0034979, GO:0032129, GO:0003674, GO:0033558
GO:0005724 [CC]nuclear telomeric heterochromatinprobableGO:0031933, GO:0031974, GO:0000781, GO:0043229, GO:0043228, GO:0000785, GO:0000784, GO:0000228, GO:0043227, GO:0043226, GO:0005575, GO:0031981, GO:0005634, GO:0044454, GO:0005694, GO:0000792, GO:0000790, GO:0005720, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0070013, GO:0044428, GO:0044424, GO:0044427, GO:0044422
GO:0010569 [BP]regulation of double-strand break repair via homologous recombinationprobableGO:0006282, GO:0051052, GO:0019222, GO:0060255, GO:0048583, GO:0080134, GO:0080135, GO:0031323, GO:0000018, GO:0050794, GO:0008150, GO:0019219, GO:0065007, GO:0051171, GO:2000779, GO:2001020, GO:0050789, GO:0080090
GO:0097372 [MF]NAD-dependent histone deacetylase activity (H3-K18 specific)probableGO:0016787, GO:0019213, GO:0034739, GO:0004407, GO:0016810, GO:0016811, GO:0017136, GO:0034979, GO:0003824, GO:0003674, GO:0033558
GO:0003682 [MF]chromatin bindingprobableGO:0003674, GO:0005488
GO:0005731 [CC]nucleolus organizer regionprobableGO:0031974, GO:0043229, GO:0043228, GO:0000785, GO:0000228, GO:0043227, GO:0043226, GO:0044446, GO:0031981, GO:0005730, GO:0005634, GO:0030874, GO:0044454, GO:0044452, GO:0005694, GO:0000790, GO:0043234, GO:0032991, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0044428, GO:0044424, GO:0044427, GO:0044422

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3K35, chain A
Confidence level:very confident
Coverage over the Query: 1-192
View the alignment between query and template
View the model in PyMOL