Diaphorina citri psyllid: psy13191


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------14
LNFSPLSVTPPSQRVQFILGEDVDDASHHAHPLFSEMEELVRNGEEMEWKETARWIKFEEDVEEGGNRWSKPHVATLSLHSLFELRSLLLNGCVMLDLEANSLEQIVDLFIEKLRTTESIPDHESSMGIWSMKKSMNNL
ccccccccccHHHHHHHHcccccccccccccccHHHHHHHHHccccHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHcccccc
***********SQRVQFILGE****ASHHAHPLFSEMEELVRNGEEMEWKETARWIKFEEDVEEGGNRWSKPHVATLSLHSLFELRSLLLNGCVMLDLEANSLEQIVDLFIEKLRTTESIPDHESSMG****K******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
LNFSPLSVTPPSQRVQFILGEDVDDASHHAHPLFSEMEELVRNGEEMEWKETARWIKFEEDVEEGGNRWSKPHVATLSLHSLFELRSLLLNGCVMLDLEANSLEQIVDLFIEKLRTTESIPDHESSMGIWSMKKSMNNL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Sodium bicarbonate cotransporter 3 Electroneutral sodium- and bicarbonate-dependent cotransporter with a Na(+):HCO3(-) 1:1 stoichiometry. Regulates intracellular pH and may play a role in bicarbonate salvage in secretory epithelia. May also have an associated sodium channel activity.confidentQ9Y6M7
Sodium bicarbonate cotransporter 3 Electroneutral sodium- and bicarbonate-dependent cotransporter with a Na(+):HCO3(-) 1:1 stoichiometry. Regulates intracellular pH and may play a role in bicarbonate salvage in secretory epithelia. May also have an associated sodium channel activity.confidentQ9R1N3

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0006821 [BP]chloride transportprobableGO:0006811, GO:0006810, GO:0006820, GO:0044765, GO:0008150, GO:0015698, GO:0051234, GO:0051179, GO:0044699
GO:0015701 [BP]bicarbonate transportprobableGO:0006811, GO:0006810, GO:0015711, GO:0044765, GO:0006820, GO:0008150, GO:0071702, GO:0051234, GO:0051179, GO:0044699
GO:0015992 [BP]proton transportprobableGO:0006818, GO:0006812, GO:0006811, GO:0006810, GO:0051179, GO:0044765, GO:0008150, GO:0051234, GO:0015672, GO:0044699
GO:0006885 [BP]regulation of pHprobableGO:0050801, GO:0048878, GO:0042592, GO:0065007, GO:0055067, GO:0055080, GO:0008150, GO:0065008
GO:0006814 [BP]sodium ion transportprobableGO:0006812, GO:0006811, GO:0006810, GO:0051179, GO:0044765, GO:0030001, GO:0008150, GO:0051234, GO:0015672, GO:0044699
GO:0031410 [CC]cytoplasmic vesicleprobableGO:0005737, GO:0031982, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043226
GO:0016323 [CC]basolateral plasma membraneprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0015301 [MF]anion:anion antiporter activityprobableGO:0022891, GO:0015297, GO:0022892, GO:0015291, GO:0005215, GO:0008509, GO:0015075, GO:0022857, GO:0003674, GO:0022804
GO:0034220 [BP]ion transmembrane transportprobableGO:0009987, GO:0006811, GO:0006810, GO:0051179, GO:0044765, GO:0044763, GO:0008150, GO:0051234, GO:0055085, GO:0044699
GO:0008510 [MF]sodium:bicarbonate symporter activityprobableGO:0022891, GO:0015294, GO:0015296, GO:0015291, GO:0015081, GO:0015293, GO:0022890, GO:0005215, GO:0008509, GO:0008324, GO:0022857, GO:0015075, GO:0015077, GO:0015106, GO:0003674, GO:0015103, GO:0022892, GO:0046873, GO:0022804

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1HYN, chain P
Confidence level:very confident
Coverage over the Query: 32-125
View the alignment between query and template
View the model in PyMOL