Diaphorina citri psyllid: psy13192

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-

MSSYDIKVHSNWCQHEYEVNLLRLIDKLTNGTTLEVNETGTTLVFQPGILVGGLIQHECCKERGIGYYLEVCLALAPFCKKGLQIVMRGVTNNQKDPSVDSFKAGGLPVLKQFLVVDPGIELIIKKRGMEPEGGGEIYFNCPIIKSIKPVQSKDMGKIKRIRGTVFALRVSPAIANRIVDTAKGILLSYLPDVYLSVDHCKGPKSGKSPGFGGSIYAESSTGVVLTADAVSPPPPATRTVPETLGEQLAYNLLEEISRGGMVDSSFQSLGCLYMALHQKDVSQLLIGPLSPYTVQFLRHLKQFFGLKFKLEHESGMVDSSFQSLGCLYMALHQKDVSQLLIGPLSPYTVQFLRHLKQFFGLKFKLERESEINPEQEEDEKPLRCGQEKVQLTCVHIFHLDT

cccccccccccccccHHHHHHHHHHHHHcccCEEEEEEccEEEEEEccEEcccEEEECccccccHHHHHHHHHHHcccccccEEEEEEEcccccccccHHHHHHcHHHHHHHcccccccEEEEEEEcccccccccEEEEEEccccccccEEEcccccEEEEEEEEEcccccHHHHHHHHHHHHHHHHHcccccEEEEEEECcccccccccCEEEEEEEEcccEEEEEEECccccccccccccHHHHHHHHHHHHHHHccccccccccHHHHHHHHHccccccEEEEccccHHHHHHHHHHHHHcccEEEEECccccCEEEEEEEEEEEEEcccccccEEEEccccHHHHHHHHHHHHHHcEEEEEECccccccccccccccccccccEEEEEEEEEEEEcc

*SSYDIKVHSNWCQHEYEVNLLRLIDKLTNGTTLEVNETGTTLVFQPGILVGGLIQHECCKERGIGYYLEVCLALAPFCKKGLQIVMRGVTNNQKDPSVDSFKAGGLPVLKQFLVVDPGIELIIKKRGMEPEGGGEIYFNCPIIKSIKPVQSKDMGKIKRIRGTVFALRVSPAIANRIVDTAKGILLSYLPDVYLSVDHCKGPKSGKSPGFGGSIYAESSTGVVLTADA**************LGEQLAYNLLEEISRGGMVDSSFQSLGCLYMALHQKDVSQLLIGPLSPYTVQFLRHLKQFFGLKFKLEHESGMVDSSFQSLGCLYMALHQKDVSQLLIGPLSPYTVQFLRHLKQFFGLKFKLER****************CGQEKVQLTCVHIFHLD*

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
RNA 3'-terminal phosphate cyclase-like protein	Does not have cyclase activity. Plays a role in 40S-ribosomal-subunit biogenesis in the early pre-rRNA processing steps at sites A0, A1 and A2 that are required for proper maturation of the 18S RNA.	confident	Q2KHX8
RNA 3'-terminal phosphate cyclase-like protein	Does not have cyclase activity. Plays a role in 40S-ribosomal-subunit biogenesis in the early pre-rRNA processing steps at sites A0, A1 and A2 that are required for proper maturation of the 18S RNA.	confident	Q9Y2P8
RNA 3'-terminal phosphate cyclase-like protein	Does not have cyclase activity. Plays a role in 40S-ribosomal-subunit biogenesis in the early pre-rRNA processing steps at sites A0, A1 and A2 that are required for proper maturation of the 18S RNA.	confident	Q9JJT0

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005730 [CC]	nucleolus	probable	GO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005783 [CC]	endoplasmic reticulum	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0006364 [BP]	rRNA processing	probable	GO:0090304, GO:0034641, GO:0006807, GO:0034660, GO:1901360, GO:0006139, GO:0044260, GO:0042254, GO:0071704, GO:0010467, GO:0071840, GO:0022613, GO:0034470, GO:0009987, GO:0006725, GO:0008150, GO:0008152, GO:0046483, GO:0016070, GO:0044238, GO:0016072, GO:0044237, GO:0043170, GO:0044085, GO:0006396
GO:0030686 [CC]	90S preribosome	probable	GO:0032991, GO:0044464, GO:0030684, GO:0005623, GO:0030529, GO:0005575, GO:0044424, GO:0005622
GO:0045335 [CC]	phagocytic vesicle	probable	GO:0005737, GO:0005575, GO:0043231, GO:0016023, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0030139, GO:0043229, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0031982
GO:0004521 [MF]	endoribonuclease activity	probable	GO:0016787, GO:0004518, GO:0004519, GO:0004540, GO:0016788, GO:0003824, GO:0003674
GO:0003963 [MF]	RNA-3'-phosphate cyclase activity	probable	GO:0009975, GO:0003824, GO:0003674, GO:0016874, GO:0016886
GO:0008047 [MF]	enzyme activator activity	probable	GO:0030234, GO:0003674

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3PQV, chain A
Confidence level:very confident
Coverage over the Query: 2-328
View the alignment between query and template
View the model in PyMOL

Template: 3PQV, chain A
Confidence level:very confident
Coverage over the Query: 68-371,386-398
View the alignment between query and template
View the model in PyMOL