Diaphorina citri psyllid: psy13204


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------19
MSLKLQTLDWIKNLSDVLDTVNNSTGLEYFELTLADADNDATESWYSVTPEKVAQHIASRCKASDVVIDGFCGCGGNTIQFAAVCQKVISIDIDPAKLRLAQHNASVYGVSHKIQFIQGDFFALAPSLQGDVVFLSPPWGGPEYARSSFSIDNIFPEQGGGRRLFQVARGISPNVGYYLPRTSDVFELF
ccccHHHHHHHcccccHHcccccccccccccccccccccccccccccccHHHHHHHHHHHcccccEEEEccccccHHHHHHHHHcccEEEEEccHHHHHHHHHHHHHHcccccEEEEEccHHHHcccccccEEEEcccccccccccccccccccccccccHHHHHHHHHHcccccEEEccccccccccc
*SLKLQTLDWIKNLSDVLDTVNNSTGLEYFELTLADADNDATESWYSVTPEKVAQHIASRCKASDVVIDGFCGCGGNTIQFAAVCQKVISIDIDPAKLRLAQHNASVYGVSHKIQFIQGDFFALAPSLQGDVVFLSPPWGGPEYARSSFSIDNIFPEQGGGRRLFQVARGISPNVGYYLPRTSDVFELF
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSLKLQTLDWIKNLSDVLDTVNNSTGLEYFELTLADADNDATESWYSVTPEKVAQHIASRCKASDVVIDGFCGCGGNTIQFAAVCQKVISIDIDPAKLRLAQHNASVYGVSHKIQFIQGDFFALAPSLQGDVVFLSPPWGGPEYARSSFSIDNIFPEQGGGRRLFQVARGISPNVGYYLPRTSDVFELF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Trimethylguanosine synthase Catalyzes the 2 serial methylation steps for the conversion of the 7-monomethylguanosine (m(7)G) caps of snRNAs and snoRNAs to a 2,2,7-trimethylguanosine (m(2,2,7)G) cap structure. The enzyme is specific for guanine, and N7 methylation must precede N2 methylation. Hypermethylation of the m7G cap of U snRNAs leads to their concentration in nuclear foci, their colocalization with coilin and the formation of canonical Cajal bodies (CBs). Plays a role in transcriptional regulation.confidentQ923W1
Trimethylguanosine synthase Catalyzes the 2 serial methylation steps for the conversion of the 7-monomethylguanosine (m(7)G) caps of snRNAs and snoRNAs to a 2,2,7-trimethylguanosine (m(2,2,7)G) cap structure. The enzyme is specific for guanine, and N7 methylation must precede N2 methylation. Hypermethylation of the m7G cap of U snRNAs leads to their concentration in nuclear foci, their colocalization with coilin and the formation of canonical Cajal bodies (CBs). Plays a role in transcriptional regulation.confidentQ96RS0
Trimethylguanosine synthase Catalyzes the 2 serial methylation steps for the conversion of the 7-monomethylguanosine (m(7)G) caps of snRNAs and snoRNAs to a 2,2,7-trimethylguanosine (m(2,2,7)G) cap structure. The enzyme is specific for guanine, and N7 methylation must precede N2 methylation. Hypermethylation of the m7G cap of U snRNAs leads to their concentration in nuclear foci, their colocalization with coilin and the formation of canonical Cajal bodies (CBs). Plays a role in transcriptional regulation.confidentP85107

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0036261 [BP]7-methylguanosine cap hypermethylationprobableGO:0036260, GO:0009451, GO:0090304, GO:0034641, GO:0006807, GO:1901360, GO:0006139, GO:0044260, GO:0071704, GO:0010467, GO:0032259, GO:0009987, GO:0006725, GO:0043412, GO:0043414, GO:0008152, GO:0001510, GO:0046483, GO:0016070, GO:0044238, GO:0044237, GO:0043170, GO:0008150, GO:0006396
GO:0071164 [MF]RNA trimethylguanosine synthase activityprobableGO:0003824, GO:0008173, GO:0016740, GO:0016741, GO:0003674, GO:0008168
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3GDH, chain A
Confidence level:very confident
Coverage over the Query: 36-188
View the alignment between query and template
View the model in PyMOL