Diaphorina citri psyllid: psy13219


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190---
MMRNVCDRDSGLTVLGTRYRCPVGIAPSAMQKLAHADGEVATARAAGMMDAIMILSLMSTTSLEEVRAQNPSTTLWLQMYIFKDRALSLQMVQRAERSGYSAIVITMDTAVLGSRYRDLKNKFTMPPYLSLANFRNLKQHNEDISKFRDISAEECSSGLTDYVANQFDDSVDWDDVRSLVQATKLPIVCKGIP
cccccccccccEEEccccccccEEEccHHHHHccccHHHHHHHHHHHHcccEEEEcccccccHHHHHHcccccccEEEEcccccHHHHHHHHHHHHHccccEEEEEEccccccccHHHHHcccccccccccccccccccccccHHHccccccccccccHHHHHHHccccccccccHHHHHHcccccEEEEccc
****VCDRDSGLTVLGTRYRCPVGIAPSAMQKLAHADGEVATARAAGMMDAIMILSLMSTTSLEEVRAQNPSTTLWLQMYIFKDRALSLQMVQRAERSGYSAIVITMDTAVLGSRYRDLKNKFTMPPYLSLANFRNLKQHNEDISKFRDISAEECSSGLTDYVANQFDDSVDWDDVRSLVQATKLPIVCKGIP
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMRNVCDRDSGLTVLGTRYRCPVGIAPSAMQKLAHADGEVATARAAGMMDAIMILSLMSTTSLEEVRAQNPSTTLWLQMYIFKDRALSLQMVQRAERSGYSAIVITMDTAVLGSRYRDLKNKFTMPPYLSLANFRNLKQHNEDISKFRDISAEECSSGLTDYVANQFDDSVDWDDVRSLVQATKLPIVCKGIP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005777 [CC]peroxisomeprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0042579, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0032787 [BP]monocarboxylic acid metabolic processprobableGO:0044710, GO:0006082, GO:0044237, GO:0009987, GO:0019752, GO:0071704, GO:0008150, GO:0044281, GO:0008152, GO:0043436
GO:0055114 [BP]oxidation-reduction processprobableGO:0044710, GO:0008150, GO:0008152
GO:0003973 [MF](S)-2-hydroxy-acid oxidase activityprobableGO:0003824, GO:0003674, GO:0016899, GO:0016614, GO:0016491

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2NZL, chain A
Confidence level:very confident
Coverage over the Query: 1-134,158-192
View the alignment between query and template
View the model in PyMOL