Diaphorina citri psyllid: psy13227


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------
MLVESTKVVRTLKVEKKLVSKGIALRKHLAKYGKSANDKPGPQSNTTIIGEEVHIQFISNKEEVEKPEEENLEKLKFISCRTCKGAHFTNNCPFKDSALFLADANKKPFNTVPGTNIMAASSDDKKSGGPGGAPGGPAIYVPPSLREGPGGKRVEGYNARRNDDTTAIRISNLSVNTSENDLEDLVKQFGPTSKMYLSRDKTNGLCKGFAYIHFKNKADAAKAIQYLNGYGYDHLILSVDWSKSTNQ
ccEEEEEEEEEEEEEEEEEcHHHHHHcccccccccccccccccccccEEccEEEEEEccccHHHccccHHHHHccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEccccccccHHHHHHHHHccccccEEEEcccccccccccEEEEEEccHHHHHHHHHHHccccccccEEEEEEcccccc
*LVESTKVVRTLKVEKKLVSKGIALRKHLAKYGKS*********NTTIIGEEVHIQFI**************EKLKFISCRTCKGAHFTNNCPFKDSALFLADANK*************************************************************IRISNLSVNTSENDLEDLVKQFGPTSKMYLSRDKTNGLCKGFAYIHFKNKADAAKAIQYLNGYGYDHLILSVDWS*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLVESTKVVRTLKVEKKLVSKGIALRKHLAKYGKSANDKPGPQSNTTIIGEEVHIQFISNKEEVEKPEEENLEKLKFISCRTCKGAHFTNNCPFKDSALFLADANKKPFNTVPGTNIMAASSDDKKSGGPGGAPGGPAIYVPPSLREGPGGKRVEGYNARRNDDTTAIRISNLSVNTSENDLEDLVKQFGPTSKMYLSRDKTNGLCKGFAYIHFKNKADAAKAIQYLNGYGYDHLILSVDWSKSTNQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Eukaryotic translation initiation factor 3 subunit G Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is involved in protein synthesis and, together with other initiation factors, stimulates binding of mRNA and methionyl-tRNAi to the 40S ribosome. This subunit can bind 18S rRNA.very confidentQ7QJV0
Eukaryotic translation initiation factor 3 subunit G-1 Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is involved in protein synthesis and, together with other initiation factors, stimulates binding of mRNA and methionyl-tRNAi to the 40S ribosome. This subunit can bind 18S rRNA.confidentQ9W4X7
Eukaryotic translation initiation factor 3 subunit G-1 Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is involved in protein synthesis and, together with other initiation factors, stimulates binding of mRNA and methionyl-tRNAi to the 40S ribosome. This subunit can bind 18S rRNA.confidentQ29GU0

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0006417 [BP]regulation of translationprobableGO:0032268, GO:0009889, GO:0080090, GO:0019222, GO:0051246, GO:0060255, GO:0010608, GO:0031323, GO:2000112, GO:0050794, GO:0050789, GO:0010556, GO:0065007, GO:0031326, GO:0008150, GO:0010468
GO:0043232 [CC]intracellular non-membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0003743 [MF]translation initiation factor activityprobableGO:0097159, GO:0008135, GO:0003674, GO:0005488, GO:0003676, GO:1901363, GO:0003723
GO:0002188 [BP]translation reinitiationprobableGO:0044249, GO:0034645, GO:0044699, GO:0044267, GO:0044260, GO:0071704, GO:0010467, GO:0002181, GO:0002183, GO:1901576, GO:0009987, GO:0009058, GO:0009059, GO:0044763, GO:0008152, GO:0044238, GO:0019538, GO:0044237, GO:0043170, GO:0008150, GO:0006413, GO:0006412
GO:0005852 [CC]eukaryotic translation initiation factor 3 complexprobableGO:0043234, GO:0005737, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0044446 [CC]intracellular organelle partprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043226, GO:0044422
GO:0030529 [CC]ribonucleoprotein complexprobableGO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2GHP, chain A
Confidence level:very confident
Coverage over the Query: 163-246
View the alignment between query and template
View the model in PyMOL
Template: 1A6B, chain B
Confidence level:probable
Coverage over the Query: 77-97
View the alignment between query and template
View the model in PyMOL