Psyllid ID: psy13227


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------
MLVESTKVVRTLKVEKKLVSKGIALRKHLAKYGKSANDKPGPQSNTTIIGEEVHIQFISNKEEVEKPEEENLEKLKFISCRTCKGAHFTNNCPFKDSALFLADANKKPFNTVPGTNIMAASSDDKKSGGPGGAPGGPAIYVPPSLREGPGGKRVEGYNARRNDDTTAIRISNLSVNTSENDLEDLVKQFGPTSKMYLSRDKTNGLCKGFAYIHFKNKADAAKAIQYLNGYGYDHLILSVDWSKSTNQ
ccEEEEEEEEEEEEEEEEEcHHHHHHcccccccccccccccccccccEEccEEEEEEccccHHHccccHHHHHHcccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEccccccccHHHHHHHHHccccccEEEEcccccccccccEEEEEEccHHHHHHHHHHHccccccccEEEEEEcccccc
ccEEEEEEEEEEEEEEEEccHHHHHHHcHHHHcHccccccccccccEEEccEEEEEEcccHHHHHHHHHHHcccccEEEEEEcccccccccccccccHHcccHHcccHHHccccccHHHcccccccccccccccccccccccccccccccccccccccccccccccEEEEEcccccccHHHHHHHHcccccEEEEEEEEEcccccccEEEEEEEccHHHHHHHHHHHcccccccEEEEEEEcccccc
MLVESTKVVRTLKVEKKLVSKGIALRKHLAKygksandkpgpqsnttiigEEVHIQFISnkeevekpeeenleklkfiscrtckgahftnncpfkdsaLFLAdankkpfntvpgtnimaassddkksggpggapggpaiyvppslregpggkrvegynarrnddttairisnlsvntsenDLEDLVKqfgptskmylsrdktnglckgFAYIHFKNKADAAKAIQYLNGYGYDHLILSVdwskstnq
mlvestkvvrtlkvekklvskgiaLRKHLakygksandkpgpqsNTTIIGEEVHIQFISNKEEVEKPEEENLEKLKFISCRTCKGAHFTNNCPFKDSALFLADANKKPFNTVPGTNIMAASSDDKKSGGPGGAPGGPAIYVPPSLREGPGGKRVegynarrnddttairisnlsvntsendlEDLVKQFGPTSKMYLSRDKTNGLCKGFAYIHFKNKADAAKAIQYLNGYGYDHLILSVDWSKSTNQ
MLVESTKVVRTLKVEKKLVSKGIALRKHLAKYGKSANDKPGPQSNTTIIGEEVHIQFISnkeevekpeeenleklkFISCRTCKGAHFTNNCPFKDSALFLADANKKPFNTVPGTNIMAassddkksggpggapggpaIYVPPSLREGPGGKRVEGYNARRNDDTTAIRISNLSVNTSENDLEDLVKQFGPTSKMYLSRDKTNGLCKGFAYIHFKNKADAAKAIQYLNGYGYDHLILSVDWSKSTNQ
********VRTLKVEKKLVSKGIALRKHL******************IIGEEVHIQFI**************EKLKFISCRTCKGAHFTNNCPFKDSALFLADANK*******************************************************************************VKQFGPTSKMYLSRDKTNGLCKGFAYIHFKNKADAAKAIQYLNGYGYDHLILSVDW******
*LVESTKVVRTLKVEKKLVSKGIALRKHLAKYGKS*********NTTIIGEEVH*************************CRTCKGAHFTNNCPFKDS**********************************************************************IRISNLSVNTSENDLEDLVKQFGPTSKMYLSRDKTNGLCKGFAYIHFKNKADAAKAIQYLNGYGYDHLILSV*WS*****
MLVESTKVVRTLKVEKKLVSKGIALRKHLAKYGKSANDKPGPQSNTTIIGEEVHIQFISNKEEVEKPEEENLEKLKFISCRTCKGAHFTNNCPFKDSALFLADANKKPFNTVPGTNIMAAS***********APGGPAIYVPPSLREGPGGKRVEGYNARRNDDTTAIRISNLSVNTSENDLEDLVKQFGPTSKMYLSRDKTNGLCKGFAYIHFKNKADAAKAIQYLNGYGYDHLILSVDWSKSTNQ
MLVESTKVVRTLKVEKKLVSKGIALRKHLAKYGKSANDKPGPQSNTTIIGEEVHIQFISNKEEVEKPEEENLEKLKFISCRTCKGAHFTNNCPFKDSALFLADANK*********************************************************DTTAIRISNLSVNTSENDLEDLVKQFGPTSKMYLSRDKTNGLCKGFAYIHFKNKADAAKAIQYLNGYGYDHLILSVDWSK****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLVESTKVVRTLKVEKKLVSKGIALRKHLAKYGKSANDKPGPQSNTTIIGEEVHIQFISNKEEVEKPEEENLEKLKFISCRTCKGAHFTNNCPFKDSALFLADANKKPFNTVPGTNIMAASSDDKKSGGPGGAPGGPAIYVPPSLREGPGGKRVEGYNARRNDDTTAIRISNLSVNTSENDLEDLVKQFGPTSKMYLSRDKTNGLCKGFAYIHFKNKADAAKAIQYLNGYGYDHLILSVDWSKSTNQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query247 2.2.26 [Sep-21-2011]
Q7QJV0271 Eukaryotic translation in yes N/A 0.890 0.811 0.506 2e-60
Q1HQN4272 Eukaryotic translation in N/A N/A 0.890 0.808 0.516 2e-59
B0VZS1272 Eukaryotic translation in N/A N/A 0.898 0.816 0.5 6e-58
B4J4G8269 Eukaryotic translation in N/A N/A 0.890 0.817 0.491 5e-56
B4N1L0269 Eukaryotic translation in N/A N/A 0.890 0.817 0.487 8e-56
B4L710269 Eukaryotic translation in N/A N/A 0.890 0.817 0.487 8e-56
B3MYX2270 Eukaryotic translation in N/A N/A 0.894 0.818 0.483 1e-55
B4MA85269 Eukaryotic translation in N/A N/A 0.890 0.817 0.487 1e-55
B4NTY9269 Eukaryotic translation in N/A N/A 0.890 0.817 0.479 1e-55
B4I9X1269 Eukaryotic translation in N/A N/A 0.890 0.817 0.479 1e-55
>sp|Q7QJV0|EIF3G_ANOGA Eukaryotic translation initiation factor 3 subunit G OS=Anopheles gambiae GN=eIF3-S4 PE=3 SV=3 Back     alignment and function desciption
 Score =  232 bits (591), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 122/241 (50%), Positives = 161/241 (66%), Gaps = 21/241 (8%)

Query: 7   KVVRTLKVEKKLVSKGIALRKHLAKYGKSANDKPGPQSNTTIIGEEVHIQFISNKEEVEK 66
           KVVRT K+ + +V K +A RK LAK+G SA D+PGP   TT++ E+V +QFI+NKEE +K
Sbjct: 49  KVVRTYKISRVVVPKCVARRKSLAKFGDSATDRPGPNPQTTMVSEDVFMQFITNKEEEQK 108

Query: 67  PEEENLEKLK-FISCRTCKGAHFTNNCPFKDSALFLADANKKPFNTVPGTNIMAASSDDK 125
             E  L+ +K  + CRTC+G H++ +CP+K+SA    D   KP  T P     ++S    
Sbjct: 109 -NENALDSMKNIVKCRTCEGEHWSFHCPYKNSAY---DKPTKP-TTAPVPETTSSSK--- 160

Query: 126 KSGGPGGAPGGPAIYVPPSLREGPGGKRVEGYNARRNDDTTAIRISNLSVNTSENDLEDL 185
                      P  YVPP ++E  G   + G   R  DDT+AIRISNLS   +E DLE+L
Sbjct: 161 -----------PGKYVPPHMKESQGKPGIGG-AMRGRDDTSAIRISNLSEAMTEADLEEL 208

Query: 186 VKQFGPTSKMYLSRDKTNGLCKGFAYIHFKNKADAAKAIQYLNGYGYDHLILSVDWSKST 245
           VK+FGP +KM+LSRDK+ GLCKGFAY+HF+++ DAA AI+ LNGYGYDHLILSV+WSK  
Sbjct: 209 VKKFGPHTKMFLSRDKSTGLCKGFAYVHFRSRRDAATAIEVLNGYGYDHLILSVEWSKPQ 268

Query: 246 N 246
           N
Sbjct: 269 N 269




Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is involved in protein synthesis and, together with other initiation factors, stimulates binding of mRNA and methionyl-tRNAi to the 40S ribosome. This subunit can bind 18S rRNA.
Anopheles gambiae (taxid: 7165)
>sp|Q1HQN4|EIF3G_AEDAE Eukaryotic translation initiation factor 3 subunit G OS=Aedes aegypti GN=eIF3-S4-1 PE=2 SV=1 Back     alignment and function description
>sp|B0VZS1|EIF3G_CULQU Eukaryotic translation initiation factor 3 subunit G OS=Culex quinquefasciatus GN=eIF3-S4 PE=3 SV=1 Back     alignment and function description
>sp|B4J4G8|EI3G1_DROGR Eukaryotic translation initiation factor 3 subunit G-1 OS=Drosophila grimshawi GN=eIF3-S4-1 PE=3 SV=1 Back     alignment and function description
>sp|B4N1L0|EI3G1_DROWI Eukaryotic translation initiation factor 3 subunit G-1 OS=Drosophila willistoni GN=eIF3-S4-1 PE=3 SV=1 Back     alignment and function description
>sp|B4L710|EI3G1_DROMO Eukaryotic translation initiation factor 3 subunit G-1 OS=Drosophila mojavensis GN=eIF3-S4-1 PE=3 SV=1 Back     alignment and function description
>sp|B3MYX2|EI3G1_DROAN Eukaryotic translation initiation factor 3 subunit G-1 OS=Drosophila ananassae GN=eIF3-S4-1 PE=3 SV=1 Back     alignment and function description
>sp|B4MA85|EI3G1_DROVI Eukaryotic translation initiation factor 3 subunit G-1 OS=Drosophila virilis GN=eIF3-S4-1 PE=3 SV=1 Back     alignment and function description
>sp|B4NTY9|EI3G1_DROSI Eukaryotic translation initiation factor 3 subunit G-1 OS=Drosophila simulans GN=eIF3-S4-1 PE=3 SV=1 Back     alignment and function description
>sp|B4I9X1|EI3G1_DROSE Eukaryotic translation initiation factor 3 subunit G-1 OS=Drosophila sechellia GN=eIF3-S4-1 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query247
332376328287 unknown [Dendroctonus ponderosae] 0.910 0.783 0.552 4e-65
242019535288 eukaryotic translation initiation factor 0.906 0.777 0.538 5e-64
270013801281 hypothetical protein TcasGA2_TC012449 [T 0.890 0.782 0.532 4e-63
383849126285 PREDICTED: eukaryotic translation initia 0.927 0.803 0.524 2e-62
307179319287 Eukaryotic translation initiation factor 0.919 0.790 0.511 1e-61
110761892285 PREDICTED: eukaryotic translation initia 0.919 0.796 0.511 5e-61
340722601285 PREDICTED: eukaryotic translation initia 0.919 0.796 0.511 9e-61
340722603283 PREDICTED: eukaryotic translation initia 0.919 0.802 0.511 1e-60
350418617285 PREDICTED: eukaryotic translation initia 0.919 0.796 0.507 2e-60
332022427287 Eukaryotic translation initiation factor 0.919 0.790 0.507 2e-60
>gi|332376328|gb|AEE63304.1| unknown [Dendroctonus ponderosae] Back     alignment and taxonomy information
 Score =  253 bits (647), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 137/248 (55%), Positives = 172/248 (69%), Gaps = 23/248 (9%)

Query: 6   TKVVRTLKVEKKLVSKGIALRKHLAKYGKSANDKPGPQSNTTIIGEEVHIQFISNKEEVE 65
            K++RT K+EK++VSK IALRK   K+G+SA DK GP   TTI+GE+V++QFIS+KEE  
Sbjct: 54  VKIIRTYKIEKRIVSKSIALRKTWKKFGESAGDKFGPNPATTIVGEDVYMQFISSKEEDM 113

Query: 66  KPEEENLEKLK------FISCRTCKGAHFTNNCPFKDSALFLADANKKPFNTVPGTNIMA 119
           KPE+E +EKLK       + CRTC   H+T  CP+KD+ L  AD  K P         MA
Sbjct: 114 KPEDEGIEKLKGLGDKNVVKCRTCGNDHWTTKCPWKDTVL--ADDKKPP---------MA 162

Query: 120 ASSDDKKSGGPGGAPGGPAIYVPPSLREGPGGKRVEGYN-ARRNDDTTAIRISNLSVNTS 178
           A +    +GG   +  G + YVPPSLR+G G KR +G N  +R+D+  AIRI+NLS +T+
Sbjct: 163 AGA----AGGSEPSKPGGSKYVPPSLRDG-GAKRSDGANMGKRDDNYCAIRIANLSGSTT 217

Query: 179 ENDLEDLVKQFGPTSKMYLSRDKTNGLCKGFAYIHFKNKADAAKAIQYLNGYGYDHLILS 238
           + DLE+LVK FGP  K+YL++DK  GLCKGFAYIHFK KADAA AI  LNGYGYDHLIL 
Sbjct: 218 DIDLEELVKPFGPIHKLYLAKDKQTGLCKGFAYIHFKFKADAANAITLLNGYGYDHLILQ 277

Query: 239 VDWSKSTN 246
           VDWSK  N
Sbjct: 278 VDWSKPVN 285




Source: Dendroctonus ponderosae

Species: Dendroctonus ponderosae

Genus: Dendroctonus

Family: Curculionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|242019535|ref|XP_002430216.1| eukaryotic translation initiation factor 3 subunit, putative [Pediculus humanus corporis] gi|212515312|gb|EEB17478.1| eukaryotic translation initiation factor 3 subunit, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|270013801|gb|EFA10249.1| hypothetical protein TcasGA2_TC012449 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|383849126|ref|XP_003700197.1| PREDICTED: eukaryotic translation initiation factor 3 subunit G-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|307179319|gb|EFN67683.1| Eukaryotic translation initiation factor 3 subunit G [Camponotus floridanus] Back     alignment and taxonomy information
>gi|110761892|ref|XP_391934.3| PREDICTED: eukaryotic translation initiation factor 3 subunit G-like [Apis mellifera] gi|380027326|ref|XP_003697378.1| PREDICTED: eukaryotic translation initiation factor 3 subunit G-like [Apis florea] Back     alignment and taxonomy information
>gi|340722601|ref|XP_003399692.1| PREDICTED: eukaryotic translation initiation factor 3 subunit G-like isoform 1 [Bombus terrestris] Back     alignment and taxonomy information
>gi|340722603|ref|XP_003399693.1| PREDICTED: eukaryotic translation initiation factor 3 subunit G-like isoform 2 [Bombus terrestris] Back     alignment and taxonomy information
>gi|350418617|ref|XP_003491916.1| PREDICTED: eukaryotic translation initiation factor 3 subunit G-like isoform 1 [Bombus impatiens] Back     alignment and taxonomy information
>gi|332022427|gb|EGI62735.1| Eukaryotic translation initiation factor 3 subunit G [Acromyrmex echinatior] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query247
FB|FBgn0029629269 CG8636 [Drosophila melanogaste 0.417 0.382 0.626 4.2e-51
FB|FBgn0038796273 CG10881 [Drosophila melanogast 0.910 0.824 0.433 1.2e-47
ZFIN|ZDB-GENE-040426-1076293 eif3g "eukaryotic translation 0.429 0.361 0.518 2.2e-42
UNIPROTKB|Q6DJI8308 eif3g-a "Eukaryotic translatio 0.429 0.344 0.541 3.6e-42
UNIPROTKB|Q28CY2310 eif3g "Eukaryotic translation 0.429 0.341 0.541 5.9e-42
UNIPROTKB|Q641B2308 eif3g-b "Eukaryotic translatio 0.429 0.344 0.541 7.5e-42
UNIPROTKB|F2Z4J5320 EIF3G "Eukaryotic translation 0.429 0.331 0.532 7.5e-42
UNIPROTKB|Q3ZC12320 EIF3G "Eukaryotic translation 0.429 0.331 0.532 7.5e-42
UNIPROTKB|E2RGG6320 EIF3G "Eukaryotic translation 0.429 0.331 0.532 7.5e-42
UNIPROTKB|O75821320 EIF3G "Eukaryotic translation 0.429 0.331 0.532 7.5e-42
FB|FBgn0029629 CG8636 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 342 (125.4 bits), Expect = 4.2e-51, Sum P(2) = 4.2e-51
 Identities = 67/107 (62%), Positives = 79/107 (73%)

Query:   140 YVPPSLREGPGGKRVEGYNARRNDDTTAIRISNLSVNTSENDLEDLVKQFGPTSKMYLSR 199
             YVPP L++   G        R  DDT AIRISNLS + +E DLE+LVK+ GP SKMYL+R
Sbjct:   166 YVPPFLKDSQKG----ALGMRGRDDTAAIRISNLSESMTEADLEELVKKIGPQSKMYLAR 221

Query:   200 DKTNGLCKGFAYIHFKNKADAAKAIQYLNGYGYDHLILSVDWSKSTN 246
             DK  GLCKGFAY+HFK + DAA AI+ LNG+GYDHLILSV+WSK  N
Sbjct:   222 DKNTGLCKGFAYVHFKQRKDAAAAIEILNGHGYDHLILSVEWSKPQN 268


GO:0006413 "translational initiation" evidence=ISS
GO:0005852 "eukaryotic translation initiation factor 3 complex" evidence=ISS
GO:0003743 "translation initiation factor activity" evidence=ISS
GO:0003729 "mRNA binding" evidence=ISS
GO:0008270 "zinc ion binding" evidence=IEA
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0000166 "nucleotide binding" evidence=IEA
GO:0007052 "mitotic spindle organization" evidence=IMP
GO:0000022 "mitotic spindle elongation" evidence=IMP
GO:0007067 "mitosis" evidence=IMP
FB|FBgn0038796 CG10881 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-1076 eif3g "eukaryotic translation initiation factor 3, subunit G" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q6DJI8 eif3g-a "Eukaryotic translation initiation factor 3 subunit G-A" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
UNIPROTKB|Q28CY2 eif3g "Eukaryotic translation initiation factor 3 subunit G" [Xenopus (Silurana) tropicalis (taxid:8364)] Back     alignment and assigned GO terms
UNIPROTKB|Q641B2 eif3g-b "Eukaryotic translation initiation factor 3 subunit G-B" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
UNIPROTKB|F2Z4J5 EIF3G "Eukaryotic translation initiation factor 3 subunit G" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q3ZC12 EIF3G "Eukaryotic translation initiation factor 3 subunit G" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RGG6 EIF3G "Eukaryotic translation initiation factor 3 subunit G" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|O75821 EIF3G "Eukaryotic translation initiation factor 3 subunit G" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q2U002EIF3G_ASPORNo assigned EC number0.35170.91090.7839yesN/A
Q5RK09EIF3G_RATNo assigned EC number0.40780.91490.7062yesN/A
Q4X1I3EIF3G_ASPFUNo assigned EC number0.34260.91090.7758yesN/A
Q9Z1D1EIF3G_MOUSENo assigned EC number0.40850.90680.7yesN/A
Q7QJV0EIF3G_ANOGANo assigned EC number0.50620.89060.8118yesN/A
P78795EIF3G_SCHPONo assigned EC number0.32270.90680.7943yesN/A
O75821EIF3G_HUMANNo assigned EC number0.40780.91490.7062yesN/A
Q9W4X7EI3G1_DROMENo assigned EC number0.47930.89060.8178yesN/A
Q1HQN4EIF3G_AEDAENo assigned EC number0.51630.89060.8088N/AN/A
Q28CY2EIF3G_XENTRNo assigned EC number0.42230.93520.7451yesN/A
A2R7Z2EIF3G_ASPNCNo assigned EC number0.34660.90680.7777yesN/A
Q6DRC4EIF3G_DANRENo assigned EC number0.40630.92710.7815yesN/A
Q3ZC12EIF3G_BOVINNo assigned EC number0.40780.91490.7062yesN/A
Q29GU0EI3G1_DROPSNo assigned EC number0.48340.89060.8178yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query247
cd1240877 cd12408, RRM_eIF3G_like, RNA recognition motif in 6e-36
cd12933114 cd12933, eIF3G, eIF3G domain found in eukaryotic t 3e-33
pfam12353126 pfam12353, eIF3g, Eukaryotic translation initiatio 3e-33
smart0036073 smart00360, RRM, RNA recognition motif 3e-17
cd0059072 cd00590, RRM_SF, RNA recognition motif (RRM) super 2e-15
pfam0007670 pfam00076, RRM_1, RNA recognition motif 3e-13
cd1236378 cd12363, RRM_TRA2, RNA recognition motif in transf 2e-11
cd1238280 cd12382, RRM_RBMX_like, RNA recognition motif in h 2e-11
cd1241476 cd12414, RRM2_RBM28_like, RNA recognition motif 2 3e-11
cd1231674 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition mot 3e-11
cd1238977 cd12389, RRM2_RAVER, RNA recognition motif 2 in ri 4e-11
COG0724 306 COG0724, COG0724, RNA-binding proteins (RRM domain 8e-11
cd1237778 cd12377, RRM3_Hu, RNA recognition motif 3 in the H 9e-11
cd1228473 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 1e-10
cd1239978 cd12399, RRM_HP0827_like, RNA recognition motif in 2e-10
cd1236573 cd12365, RRM_RNPS1, RNA recognition motif in RNA-b 3e-10
cd1224078 cd12240, RRM_NCBP2, RNA recognition motif found in 4e-10
cd1256679 cd12566, RRM2_MRD1, RNA recognition motif 2 in yea 4e-10
cd1224371 cd12243, RRM1_MSSP, RNA recognition motif 1 in the 6e-10
cd1225172 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 1e-09
cd1231173 cd12311, RRM_SRSF2_SRSF8, RNA recognition motif in 1e-09
cd1244980 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in 2e-09
cd1241582 cd12415, RRM3_RBM28_like, RNA recognition motif 3 5e-09
pfam1425969 pfam14259, RRM_6, RNA recognition motif (a 8e-09
cd1232488 cd12324, RRM_RBM8, RNA recognition motif in RNA-bi 9e-09
cd1241379 cd12413, RRM1_RBM28_like, RNA recognition motif 1 1e-08
cd1239875 cd12398, RRM_CSTF2_RNA15_like, RNA recognition mot 2e-08
cd1264279 cd12642, RRM_TRA2A, RNA recognition motif in trans 2e-08
cd1239281 cd12392, RRM2_SART3, RNA recognition motif 2 in sq 2e-08
cd1264189 cd12641, RRM_TRA2B, RNA recognition motif in Trans 2e-08
cd1229878 cd12298, RRM3_Prp24, RNA recognition motif 3 in fu 2e-08
TIGR01661352 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing f 3e-08
cd1265585 cd12655, RRM3_HuC, RNA recognition motif 3 in vert 5e-08
cd1240984 cd12409, RRM1_RRT5, RNA recognition motif 1 in yea 9e-08
cd1237276 cd12372, RRM_CFIm68_CFIm59, RNA recognition motif 1e-07
cd1267479 cd12674, RRM1_Nop4p, RNA recognition motif 1 in ye 1e-07
cd1237577 cd12375, RRM1_Hu_like, RNA recognition motif 1 in 1e-07
cd1236177 cd12361, RRM1_2_CELF1-6_like, RNA recognition moti 1e-07
cd1233474 cd12334, RRM1_SF3B4, RNA recognition motif 1 in sp 2e-07
cd1228373 cd12283, RRM1_RBM39_like, RNA recognition motif 1 3e-07
cd1238080 cd12380, RRM3_I_PABPs, RNA recognition motif 3 fou 3e-07
cd1231384 cd12313, RRM1_RRM2_RBM5_like, RNA recognition moti 4e-07
cd1230673 cd12306, RRM_II_PABPs, RNA recognition motif in ty 4e-07
cd1256779 cd12567, RRM3_RBM19, RNA recognition motif 3 in RN 4e-07
cd1241875 cd12418, RRM_Aly_REF_like, RNA recognition motif i 5e-07
cd1223793 cd12237, RRM_snRNP35, RNA recognition motif found 6e-07
TIGR01628 562 TIGR01628, PABP-1234, polyadenylate binding protei 7e-07
cd1239573 cd12395, RRM2_RBM34, RNA recognition motif 2 in RN 8e-07
cd1265686 cd12656, RRM3_HuD, RNA recognition motif 3 in vert 9e-07
TIGR01642 509 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, la 9e-07
cd1268075 cd12680, RRM_THOC4, RNA recognition motif in THO c 1e-06
cd1265279 cd12652, RRM2_Hu, RNA recognition motif 2 in the H 1e-06
cd1265486 cd12654, RRM3_HuB, RNA recognition motif 3 in vert 1e-06
cd1237880 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in 2e-06
cd1235473 cd12354, RRM3_TIA1_like, RNA recognition motif 2 i 2e-06
cd1230774 cd12307, RRM_NIFK_like, RNA recognition motif in n 2e-06
pfam1389356 pfam13893, RRM_5, RNA recognition motif 2e-06
cd1265384 cd12653, RRM3_HuR, RNA recognition motif 3 in vert 2e-06
cd1259872 cd12598, RRM1_SRSF9, RNA recognition motif 1 in ve 2e-06
cd1223177 cd12231, RRM2_U2AF65, RNA recognition motif 2 foun 3e-06
cd1237373 cd12373, RRM_SRSF3_like, RNA recognition motif in 3e-06
cd1222777 cd12227, RRM_SCAF4_SCAF8, RNA recognition motif in 3e-06
cd1223691 cd12236, RRM_snRNP70, RNA recognition motif in U1 3e-06
cd1235375 cd12353, RRM2_TIA1_like, RNA recognition motif 2 i 3e-06
cd1237177 cd12371, RRM2_PUF60, RNA recognition motif 2 in (U 5e-06
cd1225473 cd12254, RRM_hnRNPH_ESRPs_RBM12_like, RNA recognit 5e-06
TIGR01622 457 TIGR01622, SF-CC1, splicing factor, CC1-like famil 6e-06
cd1266577 cd12665, RRM2_RAVER1, RNA recognition motif 2 foun 6e-06
cd1264981 cd12649, RRM1_SXL, RNA recognition motif 1 in Dros 7e-06
cd1222384 cd12223, RRM_SR140, RNA recognition motif (RRM) in 8e-06
cd1277384 cd12773, RRM2_HuR, RNA recognition motif 2 in vert 8e-06
cd1222678 cd12226, RRM_NOL8, RNA recognition motif in nucleo 9e-06
cd1236681 cd12366, RRM1_RBM45, RNA recognition motif 1 in RN 9e-06
cd1265179 cd12651, RRM2_SXL, RNA recognition motif 2 in Dros 1e-05
cd1238476 cd12384, RRM_RBM24_RBM38_like, RNA recognition mot 1e-05
cd1241189 cd12411, RRM_ist3_like, RNA recognition motif in i 1e-05
cd1225379 cd12253, RRM_PIN4_like, RNA recognition motif in y 2e-05
cd1233872 cd12338, RRM1_SRSF1_like, RNA recognition motif 1 2e-05
cd1239378 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc 2e-05
cd1231284 cd12312, RRM_SRSF10_SRSF12, RNA recognition motif 2e-05
cd1266677 cd12666, RRM2_RAVER2, RNA recognition motif 2 in v 2e-05
cd1265078 cd12650, RRM1_Hu, RNA recognition motif 1 in the H 3e-05
cd1236774 cd12367, RRM2_RBM45, RNA recognition motif 2 in RN 3e-05
cd1223583 cd12235, RRM_PPIL4, RNA recognition motif in pepti 3e-05
cd1236273 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in 3e-05
cd1224273 cd12242, RRM_SLIRP, RNA recognition motif found in 3e-05
cd1223472 cd12234, RRM1_AtRSp31_like, RNA recognition motif 3e-05
cd1263287 cd12632, RRM1_CELF3_4_5_6, RNA recognition motif 1 3e-05
cd1224978 cd12249, RRM1_hnRNPR_like, RNA recognition motif 1 4e-05
cd1261780 cd12617, RRM2_TIAR, RNA recognition motif 2 in nuc 4e-05
cd1229080 cd12290, RRM1_LARP7, RNA recognition motif 1 in La 5e-05
TIGR01659 346 TIGR01659, sex-lethal, sex-lethal family splicing 5e-05
cd1259972 cd12599, RRM1_SF2_plant_like, RNA recognition moti 5e-05
cd1244873 cd12448, RRM2_gar2, RNA recognition motif 2 in yea 6e-05
cd1259375 cd12593, RRM_RBM11, RNA recognition motif in verte 7e-05
cd1226777 cd12267, RRM_YRA1_MLO3, RNA recognition motif in y 7e-05
cd1237679 cd12376, RRM2_Hu_like, RNA recognition motif 2 in 7e-05
cd1238772 cd12387, RRM3_hnRNPM_like, RNA recognition motif 3 7e-05
cd1245077 cd12450, RRM1_NUCLs, RNA recognition motif 1 found 7e-05
cd1260968 cd12609, RRM2_CoAA, RNA recognition motif 2 in ver 8e-05
cd1263780 cd12637, RRM2_FCA, RNA recognition motif 2 in plan 8e-05
cd1227371 cd12273, RRM1_NEFsp, RNA recognition motif 1 in ve 8e-05
cd1267583 cd12675, RRM2_Nop4p, RNA recognition motif 2 in ye 8e-05
cd1276981 cd12769, RRM1_HuR, RNA recognition motif 1 in vert 8e-05
TIGR01628 562 TIGR01628, PABP-1234, polyadenylate binding protei 1e-04
cd1257574 cd12575, RRM1_hnRNPD_like, RNA recognition motif 1 1e-04
cd1277284 cd12772, RRM1_HuC, RNA recognition motif 1 in vert 1e-04
cd1231072 cd12310, RRM3_Spen, RNA recognition motif 3 in the 1e-04
cd1235272 cd12352, RRM1_TIA1_like, RNA recognition motif 1 i 1e-04
cd1253483 cd12534, RRM_SARFH, RNA recognition motif in Droso 2e-04
cd1241774 cd12417, RRM_SAFB_like, RNA recognition motif in t 2e-04
cd1267175 cd12671, RRM_CSTF2_CSTF2T, RNA recognition motif i 2e-04
cd1234672 cd12346, RRM3_NGR1_NAM8_like, RNA recognition moti 2e-04
cd1255277 cd12552, RRM_Nop15p, RNA recognition motif in yeas 2e-04
cd1233583 cd12335, RRM2_SF3B4, RNA recognition motif 2 in sp 2e-04
cd1261880 cd12618, RRM2_TIA1, RNA recognition motif 2 in nuc 2e-04
TIGR01645 612 TIGR01645, half-pint, poly-U binding splicing fact 2e-04
TIGR01661 352 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing f 3e-04
cd1259773 cd12597, RRM1_SRSF1, RNA recognition motif 1 in se 3e-04
cd1257980 cd12579, RRM2_hnRNPA0, RNA recognition motif 2 in 3e-04
cd1232374 cd12323, RRM2_MSI, RNA recognition motif 2 in RNA- 3e-04
cd1227884 cd12278, RRM_eIF3B, RNA recognition motif in eukar 3e-04
cd1248678 cd12486, RRM1_ACF, RNA recognition motif 1 found i 3e-04
cd1277183 cd12771, RRM1_HuB, RNA recognition motif 1 in vert 4e-04
cd1235580 cd12355, RRM_RBM18, RNA recognition motif in eukar 4e-04
cd1247588 cd12475, RRM2_RBMS3, RNA recognition motif 2 found 4e-04
cd1245480 cd12454, RRM2_RIM4_like, RNA recognition motif 2 i 4e-04
cd1233271 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 4e-04
cd1247086 cd12470, RRM1_MSSP1, RNA recognition motif 1 in ve 4e-04
cd1256181 cd12561, RRM1_RBM5_like, RNA recognition motif 1 i 4e-04
cd1255984 cd12559, RRM_SRSF10, RNA recognition motif in seri 4e-04
cd1223873 cd12238, RRM1_RBM40_like, RNA recognition motif 1 4e-04
cd1224177 cd12241, RRM_SF3B14, RNA recognition motif found i 4e-04
cd1231882 cd12318, RRM5_RBM19_like, RNA recognition motif 5 5e-04
cd1227272 cd12272, RRM2_PHIP1, RNA recognition motif 2 in Ar 5e-04
cd1239172 cd12391, RRM1_SART3, RNA recognition motif 1 in sq 5e-04
cd1231772 cd12317, RRM4_RBM19_RRM3_MRD1, RNA recognition mot 5e-04
cd1247175 cd12471, RRM1_MSSP2, RNA recognition motif 1 in ve 6e-04
cd1232076 cd12320, RRM6_RBM19_RRM5_MRD1, RNA recognition mot 6e-04
cd1277481 cd12774, RRM2_HuD, RNA recognition motif 2 in vert 6e-04
cd1257274 cd12572, RRM2_MSI1, RNA recognition motif 2 in RNA 7e-04
cd1261975 cd12619, RRM2_PUB1, RNA recognition motif 2 in yea 7e-04
cd1268169 cd12681, RRM_SKAR, RNA recognition motif in S6K1 A 7e-04
cd1264581 cd12645, RRM_SRSF3, RNA recognition motif in verte 8e-04
cd1252477 cd12524, RRM1_MEI2_like, RNA recognition motif 1 i 8e-04
cd1256084 cd12560, RRM_SRSF12, RNA recognition motif in seri 8e-04
cd1277681 cd12776, RRM2_HuC, RNA recognition motif 2 in vert 8e-04
cd1275775 cd12757, RRM1_hnRNPAB, RNA recognition motif 1 in 8e-04
cd1239773 cd12397, RRM2_Nop13p_fungi, RNA recognition motif 8e-04
cd1238179 cd12381, RRM4_I_PABPs, RNA recognition motif 4 in 9e-04
cd1252378 cd12523, RRM2_MRN1, RNA recognition motif 2 of RNA 9e-04
cd12676107 cd12676, RRM3_Nop4p, RNA recognition motif 3 in ye 0.001
cd1277083 cd12770, RRM1_HuD, RNA recognition motif 1 in vert 0.001
cd1277590 cd12775, RRM2_HuB, RNA recognition motif 2 in vert 0.001
cd1242174 cd12421, RRM1_PTBP1_hnRNPL_like, RNA recognition m 0.001
cd1237977 cd12379, RRM2_I_PABPs, RNA recognition motif 2 fou 0.001
cd1260869 cd12608, RRM1_CoAA, RNA recognition motif 1 in ver 0.001
TIGR01628 562 TIGR01628, PABP-1234, polyadenylate binding protei 0.002
cd1234366 cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 0.002
cd1260667 cd12606, RRM1_RBM4, RNA recognition motif 1 in ver 0.002
cd1231577 cd12315, RRM1_RBM19_MRD1, RNA recognition motif 1 0.002
cd1229778 cd12297, RRM2_Prp24, RNA recognition motif 2 in fu 0.002
cd1244776 cd12447, RRM1_gar2, RNA recognition motif 1 in yea 0.002
cd1275876 cd12758, RRM1_hnRPDL, RNA recognition motif 1 in h 0.002
cd1223370 cd12233, RRM_Srp1p_AtRSp31_like, RNA recognition m 0.002
cd1232177 cd12321, RRM1_TDP43, RNA recognition motif 1 in TA 0.002
cd1228585 cd12285, RRM3_RBM39_like, RNA recognition motif 3 0.002
cd1232873 cd12328, RRM2_hnRNPA_like, RNA recognition motif 2 0.002
cd1257776 cd12577, RRM1_Hrp1p, RNA recognition motif 1 in ye 0.003
cd1229574 cd12295, RRM_YRA2, RNA recognition motif in yeast 0.003
cd1259275 cd12592, RRM_RBM7, RNA recognition motif in verteb 0.003
cd1268775 cd12687, RRM1_PTBPH3, RNA recognition motif 1 in p 0.003
cd1233675 cd12336, RRM_RBM7_like, RNA recognition motif in R 0.003
cd1234067 cd12340, RBD_RRM1_NPL3, RNA recognition motif 1 in 0.003
cd1247280 cd12472, RRM1_RBMS3, RNA recognition motif 1 found 0.004
cd1233770 cd12337, RRM1_SRSF4_like, RNA recognition motif 1 0.004
cd1247486 cd12474, RRM2_MSSP2, RNA recognition motif 2 found 0.004
cd1240477 cd12404, RRM2_NCL, RNA recognition motif 2 in vert 0.004
cd1222981 cd12229, RRM_G3BP, RNA recognition motif (RRM) in 0.004
cd1248279 cd12482, RRM1_hnRNPR, RNA recognition motif 1 in v 0.004
>gnl|CDD|240854 cd12408, RRM_eIF3G_like, RNA recognition motif in eukaryotic translation initiation factor 3 subunit G (eIF-3G) and similar proteins Back     alignment and domain information
 Score =  121 bits (307), Expect = 6e-36
 Identities = 39/77 (50%), Positives = 59/77 (76%)

Query: 167 AIRISNLSVNTSENDLEDLVKQFGPTSKMYLSRDKTNGLCKGFAYIHFKNKADAAKAIQY 226
            IR++NLS +  E+DL +L + FGP S++YL++DK  G  +GFA++ F  + DA +AI+ 
Sbjct: 1   TIRVTNLSEDADEDDLRELFRPFGPISRVYLAKDKETGQSRGFAFVTFHTREDAERAIEK 60

Query: 227 LNGYGYDHLILSVDWSK 243
           LNG+GYD+LILSV+W+K
Sbjct: 61  LNGFGYDNLILSVEWAK 77


This subfamily corresponds to the RRM of eIF-3G and similar proteins. eIF-3G, also termed eIF-3 subunit 4, or eIF-3-delta, or eIF3-p42, or eIF3-p44, is the RNA-binding subunit of eIF3, a large multisubunit complex that plays a central role in the initiation of translation by binding to the 40 S ribosomal subunit and promoting the binding of methionyl-tRNAi and mRNA. eIF-3G binds 18 S rRNA and beta-globin mRNA, and therefore appears to be a nonspecific RNA-binding protein. eIF-3G is one of the cytosolic targets and interacts with mature apoptosis-inducing factor (AIF). eIF-3G contains one RNA recognition motif (RRM), also termed RBD (RNA binding domain) or RNP (ribonucleoprotein domain). This family also includes yeast eIF3-p33, a homolog of vertebrate eIF-3G, plays an important role in the initiation phase of protein synthesis in yeast. It binds both, mRNA and rRNA, fragments due to an RRM near its C-terminus. . Length = 77

>gnl|CDD|240597 cd12933, eIF3G, eIF3G domain found in eukaryotic translation initiation factor 3 subunit G (eIF-3G) and similar proteins Back     alignment and domain information
>gnl|CDD|221544 pfam12353, eIF3g, Eukaryotic translation initiation factor 3 subunit G Back     alignment and domain information
>gnl|CDD|214636 smart00360, RRM, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily Back     alignment and domain information
>gnl|CDD|215696 pfam00076, RRM_1, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240809 cd12363, RRM_TRA2, RNA recognition motif in transformer-2 protein homolog TRA2-alpha, TRA2-beta and similar proteins Back     alignment and domain information
>gnl|CDD|240828 cd12382, RRM_RBMX_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein G (hnRNP G), Y chromosome RNA recognition motif 1 (hRBMY), testis-specific heterogeneous nuclear ribonucleoprotein G-T (hnRNP G-T) and similar proteins Back     alignment and domain information
>gnl|CDD|240860 cd12414, RRM2_RBM28_like, RNA recognition motif 2 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240762 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and RNA recognition motif 2 found in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|240835 cd12389, RRM2_RAVER, RNA recognition motif 2 in ribonucleoprotein PTB-binding raver-1, raver-2 and similar proteins Back     alignment and domain information
>gnl|CDD|223796 COG0724, COG0724, RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>gnl|CDD|240823 cd12377, RRM3_Hu, RNA recognition motif 3 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|240730 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 in vertebrate RNA-binding protein RBM23, RBM39 and similar proteins Back     alignment and domain information
>gnl|CDD|240845 cd12399, RRM_HP0827_like, RNA recognition motif in Helicobacter pylori HP0827 protein and similar proteins Back     alignment and domain information
>gnl|CDD|240811 cd12365, RRM_RNPS1, RNA recognition motif in RNA-binding protein with serine-rich domain 1 (RNPS1) and similar proteins Back     alignment and domain information
>gnl|CDD|240686 cd12240, RRM_NCBP2, RNA recognition motif found in nuclear cap-binding protein subunit 2 (CBP20) and similar proteins Back     alignment and domain information
>gnl|CDD|241010 cd12566, RRM2_MRD1, RNA recognition motif 2 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240689 cd12243, RRM1_MSSP, RNA recognition motif 1 in the c-myc gene single-strand binding proteins (MSSP) family Back     alignment and domain information
>gnl|CDD|240697 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 in heterogeneous nuclear ribonucleoprotein R (hnRNP R) and similar proteins Back     alignment and domain information
>gnl|CDD|240757 cd12311, RRM_SRSF2_SRSF8, RNA recognition motif in serine/arginine-rich splicing factor SRSF2, SRSF8 and similar proteins Back     alignment and domain information
>gnl|CDD|240895 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in cold inducible RNA binding protein (CIRBP), RNA binding motif protein 3 (RBM3) and similar proteins Back     alignment and domain information
>gnl|CDD|240861 cd12415, RRM3_RBM28_like, RNA recognition motif 3 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|222631 pfam14259, RRM_6, RNA recognition motif (a Back     alignment and domain information
>gnl|CDD|240770 cd12324, RRM_RBM8, RNA recognition motif in RNA-binding protein RBM8A, RBM8B nd similar proteins Back     alignment and domain information
>gnl|CDD|240859 cd12413, RRM1_RBM28_like, RNA recognition motif 1 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240844 cd12398, RRM_CSTF2_RNA15_like, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), yeast ortholog mRNA 3'-end-processing protein RNA15 and similar proteins Back     alignment and domain information
>gnl|CDD|241086 cd12642, RRM_TRA2A, RNA recognition motif in transformer-2 protein homolog alpha (TRA-2 alpha) and similar proteins Back     alignment and domain information
>gnl|CDD|240838 cd12392, RRM2_SART3, RNA recognition motif 2 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins Back     alignment and domain information
>gnl|CDD|241085 cd12641, RRM_TRA2B, RNA recognition motif in Transformer-2 protein homolog beta (TRA-2 beta) and similar proteins Back     alignment and domain information
>gnl|CDD|240744 cd12298, RRM3_Prp24, RNA recognition motif 3 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins Back     alignment and domain information
>gnl|CDD|233516 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing factor Back     alignment and domain information
>gnl|CDD|241099 cd12655, RRM3_HuC, RNA recognition motif 3 in vertebrate Hu-antigen C (HuC) Back     alignment and domain information
>gnl|CDD|240855 cd12409, RRM1_RRT5, RNA recognition motif 1 in yeast regulator of rDNA transcription protein 5 (RRT5) and similar proteins Back     alignment and domain information
>gnl|CDD|240818 cd12372, RRM_CFIm68_CFIm59, RNA recognition motif of pre-mRNA cleavage factor Im 68 kDa subunit (CFIm68 or CPSF6), pre-mRNA cleavage factor Im 59 kDa subunit (CFIm59 or CPSF7), and similar proteins Back     alignment and domain information
>gnl|CDD|241118 cd12674, RRM1_Nop4p, RNA recognition motif 1 in yeast nucleolar protein 4 (Nop4p) and similar proteins Back     alignment and domain information
>gnl|CDD|240821 cd12375, RRM1_Hu_like, RNA recognition motif 1 in the Hu proteins family, Drosophila sex-lethal (SXL), and similar proteins Back     alignment and domain information
>gnl|CDD|240807 cd12361, RRM1_2_CELF1-6_like, RNA recognition motif 1 and 2 in CELF/Bruno-like family of RNA binding proteins and plant flowering time control protein FCA Back     alignment and domain information
>gnl|CDD|240780 cd12334, RRM1_SF3B4, RNA recognition motif 1 in splicing factor 3B subunit 4 (SF3B4) and similar proteins Back     alignment and domain information
>gnl|CDD|240729 cd12283, RRM1_RBM39_like, RNA recognition motif 1 in vertebrate RNA-binding protein 39 (RBM39) and similar proteins Back     alignment and domain information
>gnl|CDD|240826 cd12380, RRM3_I_PABPs, RNA recognition motif 3 found in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240759 cd12313, RRM1_RRM2_RBM5_like, RNA recognition motif 1 and 2 in RNA-binding protein 5 (RBM5) and similar proteins Back     alignment and domain information
>gnl|CDD|240752 cd12306, RRM_II_PABPs, RNA recognition motif in type II polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|241011 cd12567, RRM3_RBM19, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and similar proteins Back     alignment and domain information
>gnl|CDD|240864 cd12418, RRM_Aly_REF_like, RNA recognition motif in the Aly/REF family Back     alignment and domain information
>gnl|CDD|240683 cd12237, RRM_snRNP35, RNA recognition motif found in U11/U12 small nuclear ribonucleoprotein 35 kDa protein (U11/U12-35K) and similar proteins Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|240841 cd12395, RRM2_RBM34, RNA recognition motif 2 in RNA-binding protein 34 (RBM34) and similar proteins Back     alignment and domain information
>gnl|CDD|241100 cd12656, RRM3_HuD, RNA recognition motif 3 in vertebrate Hu-antigen D (HuD) Back     alignment and domain information
>gnl|CDD|233503 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>gnl|CDD|241124 cd12680, RRM_THOC4, RNA recognition motif in THO complex subunit 4 (THOC4) and similar proteins Back     alignment and domain information
>gnl|CDD|241096 cd12652, RRM2_Hu, RNA recognition motif 2 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|241098 cd12654, RRM3_HuB, RNA recognition motif 3 in vertebrate Hu-antigen B (HuB) Back     alignment and domain information
>gnl|CDD|240824 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240800 cd12354, RRM3_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins (p40-TIA-1 and TIAR), and yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 Back     alignment and domain information
>gnl|CDD|240753 cd12307, RRM_NIFK_like, RNA recognition motif in nucleolar protein interacting with the FHA domain of pKI-67 (NIFK) and similar proteins Back     alignment and domain information
>gnl|CDD|206064 pfam13893, RRM_5, RNA recognition motif Back     alignment and domain information
>gnl|CDD|241097 cd12653, RRM3_HuR, RNA recognition motif 3 in vertebrate Hu-antigen R (HuR) Back     alignment and domain information
>gnl|CDD|241042 cd12598, RRM1_SRSF9, RNA recognition motif 1 in vertebrate serine/arginine-rich splicing factor 9 (SRSF9) Back     alignment and domain information
>gnl|CDD|240677 cd12231, RRM2_U2AF65, RNA recognition motif 2 found in U2 large nuclear ribonucleoprotein auxiliary factor U2AF 65 kDa subunit (U2AF65) and similar proteins Back     alignment and domain information
>gnl|CDD|240819 cd12373, RRM_SRSF3_like, RNA recognition motif in serine/arginine-rich splicing factor 3 (SRSF3) and similar proteins Back     alignment and domain information
>gnl|CDD|240673 cd12227, RRM_SCAF4_SCAF8, RNA recognition motif in SR-related and CTD-associated factor 4 (SCAF4), SR-related and CTD-associated factor 8 (SCAF8) and similar proteins Back     alignment and domain information
>gnl|CDD|240682 cd12236, RRM_snRNP70, RNA recognition motif in U1 small nuclear ribonucleoprotein 70 kDa (U1-70K) and similar proteins Back     alignment and domain information
>gnl|CDD|240799 cd12353, RRM2_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins p40-TIA-1 and TIAR Back     alignment and domain information
>gnl|CDD|240817 cd12371, RRM2_PUF60, RNA recognition motif 2 in (U)-binding-splicing factor PUF60 and similar proteins Back     alignment and domain information
>gnl|CDD|240700 cd12254, RRM_hnRNPH_ESRPs_RBM12_like, RNA recognition motif found in heterogeneous nuclear ribonucleoprotein (hnRNP) H protein family, epithelial splicing regulatory proteins (ESRPs), Drosophila RNA-binding protein Fusilli, RNA-binding protein 12 (RBM12) and similar proteins Back     alignment and domain information
>gnl|CDD|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family Back     alignment and domain information
>gnl|CDD|241109 cd12665, RRM2_RAVER1, RNA recognition motif 2 found in vertebrate ribonucleoprotein PTB-binding 1 (raver-1) Back     alignment and domain information
>gnl|CDD|241093 cd12649, RRM1_SXL, RNA recognition motif 1 in Drosophila sex-lethal (SXL) and similar proteins Back     alignment and domain information
>gnl|CDD|240669 cd12223, RRM_SR140, RNA recognition motif (RRM) in U2-associated protein SR140 and similar proteins Back     alignment and domain information
>gnl|CDD|241217 cd12773, RRM2_HuR, RNA recognition motif 2 in vertebrate Hu-antigen R (HuR) Back     alignment and domain information
>gnl|CDD|240672 cd12226, RRM_NOL8, RNA recognition motif in nucleolar protein 8 (NOL8) and similar proteins Back     alignment and domain information
>gnl|CDD|240812 cd12366, RRM1_RBM45, RNA recognition motif 1 in RNA-binding protein 45 (RBM45) and similar proteins Back     alignment and domain information
>gnl|CDD|241095 cd12651, RRM2_SXL, RNA recognition motif 2 in Drosophila sex-lethal (SXL) and similar proteins Back     alignment and domain information
>gnl|CDD|240830 cd12384, RRM_RBM24_RBM38_like, RNA recognition motif in eukaryotic RNA-binding protein RBM24, RBM38 and similar proteins Back     alignment and domain information
>gnl|CDD|240857 cd12411, RRM_ist3_like, RNA recognition motif in ist3 family Back     alignment and domain information
>gnl|CDD|240699 cd12253, RRM_PIN4_like, RNA recognition motif in yeast RNA-binding protein PIN4, fission yeast RNA-binding post-transcriptional regulators cip1, cip2 and similar proteins Back     alignment and domain information
>gnl|CDD|240784 cd12338, RRM1_SRSF1_like, RNA recognition motif 1 in serine/arginine-rich splicing factor 1 (SRSF1) and similar proteins Back     alignment and domain information
>gnl|CDD|240839 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc finger CCHC-type and RNA-binding motif-containing protein 1 (ZCRB1) and similar proteins Back     alignment and domain information
>gnl|CDD|240758 cd12312, RRM_SRSF10_SRSF12, RNA recognition motif in serine/arginine-rich splicing factor SRSF10, SRSF12 and similar proteins Back     alignment and domain information
>gnl|CDD|241110 cd12666, RRM2_RAVER2, RNA recognition motif 2 in vertebrate ribonucleoprotein PTB-binding 2 (raver-2) Back     alignment and domain information
>gnl|CDD|241094 cd12650, RRM1_Hu, RNA recognition motif 1 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|240813 cd12367, RRM2_RBM45, RNA recognition motif 2 in RNA-binding protein 45 (RBM45) and similar proteins Back     alignment and domain information
>gnl|CDD|240681 cd12235, RRM_PPIL4, RNA recognition motif in peptidyl-prolyl cis-trans isomerase-like 4 (PPIase) and similar proteins Back     alignment and domain information
>gnl|CDD|240808 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in CELF/Bruno-like family of RNA binding proteins CELF1, CELF2, CELF3, CELF4, CELF5, CELF6 and similar proteins Back     alignment and domain information
>gnl|CDD|240688 cd12242, RRM_SLIRP, RNA recognition motif found in SRA stem-loop-interacting RNA-binding protein (SLIRP) and similar proteins Back     alignment and domain information
>gnl|CDD|240680 cd12234, RRM1_AtRSp31_like, RNA recognition motif in Arabidopsis thaliana arginine/serine-rich-splicing factor RSp31 and similar proteins from plants Back     alignment and domain information
>gnl|CDD|241076 cd12632, RRM1_CELF3_4_5_6, RNA recognition motif 1 in CUGBP Elav-like family member CELF-3, CELF-4, CELF-5, CELF-6 and similar proteins Back     alignment and domain information
>gnl|CDD|240695 cd12249, RRM1_hnRNPR_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein R (hnRNP R) and similar proteins Back     alignment and domain information
>gnl|CDD|241061 cd12617, RRM2_TIAR, RNA recognition motif 2 in nucleolysin TIAR and similar proteins Back     alignment and domain information
>gnl|CDD|240736 cd12290, RRM1_LARP7, RNA recognition motif 1 in La-related protein 7 (LARP7) and similar proteins Back     alignment and domain information
>gnl|CDD|233515 TIGR01659, sex-lethal, sex-lethal family splicing factor Back     alignment and domain information
>gnl|CDD|241043 cd12599, RRM1_SF2_plant_like, RNA recognition motif 1 in plant pre-mRNA-splicing factor SF2 and similar proteins Back     alignment and domain information
>gnl|CDD|240894 cd12448, RRM2_gar2, RNA recognition motif 2 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|241037 cd12593, RRM_RBM11, RNA recognition motif in vertebrate RNA-binding protein 11 (RBM11) Back     alignment and domain information
>gnl|CDD|240713 cd12267, RRM_YRA1_MLO3, RNA recognition motif in yeast RNA annealing protein YRA1 (Yra1p), yeast mRNA export protein mlo3 and similar proteins Back     alignment and domain information
>gnl|CDD|240822 cd12376, RRM2_Hu_like, RNA recognition motif 2 in the Hu proteins family, Drosophila sex-lethal (SXL), and similar proteins Back     alignment and domain information
>gnl|CDD|240833 cd12387, RRM3_hnRNPM_like, RNA recognition motif 3 in heterogeneous nuclear ribonucleoprotein M (hnRNP M) and similar proteins Back     alignment and domain information
>gnl|CDD|240896 cd12450, RRM1_NUCLs, RNA recognition motif 1 found in nucleolin-like proteins mainly from plants Back     alignment and domain information
>gnl|CDD|241053 cd12609, RRM2_CoAA, RNA recognition motif 2 in vertebrate RRM-containing coactivator activator/modulator (CoAA) Back     alignment and domain information
>gnl|CDD|241081 cd12637, RRM2_FCA, RNA recognition motif 2 in plant flowering time control protein FCA and similar proteins Back     alignment and domain information
>gnl|CDD|240719 cd12273, RRM1_NEFsp, RNA recognition motif 1 in vertebrate putative RNA exonuclease NEF-sp Back     alignment and domain information
>gnl|CDD|241119 cd12675, RRM2_Nop4p, RNA recognition motif 2 in yeast nucleolar protein 4 (Nop4p) and similar proteins Back     alignment and domain information
>gnl|CDD|241213 cd12769, RRM1_HuR, RNA recognition motif 1 in vertebrate Hu-antigen R (HuR) Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|241019 cd12575, RRM1_hnRNPD_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein hnRNP D0, hnRNP A/B, hnRNP DL and similar proteins Back     alignment and domain information
>gnl|CDD|241216 cd12772, RRM1_HuC, RNA recognition motif 1 in vertebrate Hu-antigen C (HuC) Back     alignment and domain information
>gnl|CDD|240756 cd12310, RRM3_Spen, RNA recognition motif 3 in the Spen (split end) protein family Back     alignment and domain information
>gnl|CDD|240798 cd12352, RRM1_TIA1_like, RNA recognition motif 1 in granule-associated RNA binding proteins p40-TIA-1 and TIAR Back     alignment and domain information
>gnl|CDD|240978 cd12534, RRM_SARFH, RNA recognition motif in Drosophila melanogaster RNA-binding protein cabeza and similar proteins Back     alignment and domain information
>gnl|CDD|240863 cd12417, RRM_SAFB_like, RNA recognition motif in the scaffold attachment factor (SAFB) family Back     alignment and domain information
>gnl|CDD|241115 cd12671, RRM_CSTF2_CSTF2T, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), cleavage stimulation factor subunit 2 tau variant (CSTF2T) and similar proteins Back     alignment and domain information
>gnl|CDD|240792 cd12346, RRM3_NGR1_NAM8_like, RNA recognition motif 3 in yeast negative growth regulatory protein NGR1 (RBP1), yeast protein NAM8 and similar proteins Back     alignment and domain information
>gnl|CDD|240996 cd12552, RRM_Nop15p, RNA recognition motif in yeast ribosome biogenesis protein 15 (Nop15p) and similar proteins Back     alignment and domain information
>gnl|CDD|240781 cd12335, RRM2_SF3B4, RNA recognition motif 2 in splicing factor 3B subunit 4 (SF3B4) and similar proteins Back     alignment and domain information
>gnl|CDD|241062 cd12618, RRM2_TIA1, RNA recognition motif 2 in nucleolysin TIA-1 isoform p40 (p40-TIA-1) and similar proteins Back     alignment and domain information
>gnl|CDD|130706 TIGR01645, half-pint, poly-U binding splicing factor, half-pint family Back     alignment and domain information
>gnl|CDD|233516 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing factor Back     alignment and domain information
>gnl|CDD|241041 cd12597, RRM1_SRSF1, RNA recognition motif 1 in serine/arginine-rich splicing factor 1 (SRSF1) and similar proteins Back     alignment and domain information
>gnl|CDD|241023 cd12579, RRM2_hnRNPA0, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A0 (hnRNP A0) and similar proteins Back     alignment and domain information
>gnl|CDD|240769 cd12323, RRM2_MSI, RNA recognition motif 2 in RNA-binding protein Musashi homologs Musashi-1, Musashi-2 and similar proteins Back     alignment and domain information
>gnl|CDD|240724 cd12278, RRM_eIF3B, RNA recognition motif in eukaryotic translation initiation factor 3 subunit B (eIF-3B) and similar proteins Back     alignment and domain information
>gnl|CDD|240930 cd12486, RRM1_ACF, RNA recognition motif 1 found in vertebrate APOBEC-1 complementation factor (ACF) Back     alignment and domain information
>gnl|CDD|241215 cd12771, RRM1_HuB, RNA recognition motif 1 in vertebrate Hu-antigen B (HuB) Back     alignment and domain information
>gnl|CDD|240801 cd12355, RRM_RBM18, RNA recognition motif in eukaryotic RNA-binding protein 18 and similar proteins Back     alignment and domain information
>gnl|CDD|240919 cd12475, RRM2_RBMS3, RNA recognition motif 2 found in vertebrate RNA-binding motif, single-stranded-interacting protein 3 (RBMS3) Back     alignment and domain information
>gnl|CDD|240900 cd12454, RRM2_RIM4_like, RNA recognition motif 2 in yeast meiotic activator RIM4 and similar proteins Back     alignment and domain information
>gnl|CDD|240778 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 in the p54nrb/PSF/PSP1 family Back     alignment and domain information
>gnl|CDD|240914 cd12470, RRM1_MSSP1, RNA recognition motif 1 in vertebrate single-stranded DNA-binding protein MSSP-1 Back     alignment and domain information
>gnl|CDD|241005 cd12561, RRM1_RBM5_like, RNA recognition motif 1 in RNA-binding protein 5 (RBM5) and similar proteins Back     alignment and domain information
>gnl|CDD|241003 cd12559, RRM_SRSF10, RNA recognition motif in serine/arginine-rich splicing factor 10 (SRSF10) and similar proteins Back     alignment and domain information
>gnl|CDD|240684 cd12238, RRM1_RBM40_like, RNA recognition motif 1 in RNA-binding protein 40 (RBM40) and similar proteins Back     alignment and domain information
>gnl|CDD|240687 cd12241, RRM_SF3B14, RNA recognition motif found in pre-mRNA branch site protein p14 (SF3B14) and similar proteins Back     alignment and domain information
>gnl|CDD|240764 cd12318, RRM5_RBM19_like, RNA recognition motif 5 in RNA-binding protein 19 (RBM19 or RBD-1) and similar proteins Back     alignment and domain information
>gnl|CDD|240718 cd12272, RRM2_PHIP1, RNA recognition motif 2 in Arabidopsis thaliana phragmoplastin interacting protein 1 (PHIP1) and similar proteins Back     alignment and domain information
>gnl|CDD|240837 cd12391, RRM1_SART3, RNA recognition motif 1 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins Back     alignment and domain information
>gnl|CDD|240763 cd12317, RRM4_RBM19_RRM3_MRD1, RNA recognition motif 4 in RNA-binding protein 19 (RBM19) and RNA recognition motif 3 in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|240915 cd12471, RRM1_MSSP2, RNA recognition motif 1 in vertebrate single-stranded DNA-binding protein MSSP-2 Back     alignment and domain information
>gnl|CDD|240766 cd12320, RRM6_RBM19_RRM5_MRD1, RNA recognition motif 6 in RNA-binding protein 19 (RBM19 or RBD-1) and RNA recognition motif 5 in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|241218 cd12774, RRM2_HuD, RNA recognition motif 2 in vertebrate Hu-antigen D (HuD) Back     alignment and domain information
>gnl|CDD|241016 cd12572, RRM2_MSI1, RNA recognition motif 2 in RNA-binding protein Musashi homolog 1 (Musashi-1) and similar proteins Back     alignment and domain information
>gnl|CDD|241063 cd12619, RRM2_PUB1, RNA recognition motif 2 in yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 and similar proteins Back     alignment and domain information
>gnl|CDD|241125 cd12681, RRM_SKAR, RNA recognition motif in S6K1 Aly/REF-like target (SKAR) and similar proteins Back     alignment and domain information
>gnl|CDD|241089 cd12645, RRM_SRSF3, RNA recognition motif in vertebrate serine/arginine-rich splicing factor 3 (SRSF3) Back     alignment and domain information
>gnl|CDD|240968 cd12524, RRM1_MEI2_like, RNA recognition motif 1 in plant Mei2-like proteins Back     alignment and domain information
>gnl|CDD|241004 cd12560, RRM_SRSF12, RNA recognition motif in serine/arginine-rich splicing factor 12 (SRSF12) and similar proteins Back     alignment and domain information
>gnl|CDD|241220 cd12776, RRM2_HuC, RNA recognition motif 2 in vertebrate Hu-antigen C (HuC) Back     alignment and domain information
>gnl|CDD|241201 cd12757, RRM1_hnRNPAB, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A/B (hnRNP A/B) and similar proteins Back     alignment and domain information
>gnl|CDD|240843 cd12397, RRM2_Nop13p_fungi, RNA recognition motif 2 in yeast nucleolar protein 13 (Nop13p) and similar proteins Back     alignment and domain information
>gnl|CDD|240827 cd12381, RRM4_I_PABPs, RNA recognition motif 4 in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240967 cd12523, RRM2_MRN1, RNA recognition motif 2 of RNA-binding protein MRN1 and similar proteins Back     alignment and domain information
>gnl|CDD|241120 cd12676, RRM3_Nop4p, RNA recognition motif 3 in yeast nucleolar protein 4 (Nop4p) and similar proteins Back     alignment and domain information
>gnl|CDD|241214 cd12770, RRM1_HuD, RNA recognition motif 1 in vertebrate Hu-antigen D (HuD) Back     alignment and domain information
>gnl|CDD|241219 cd12775, RRM2_HuB, RNA recognition motif 2 in vertebrate Hu-antigen B (HuB) Back     alignment and domain information
>gnl|CDD|240867 cd12421, RRM1_PTBP1_hnRNPL_like, RNA recognition motif in polypyrimidine tract-binding protein 1 (PTB or hnRNP I), heterogeneous nuclear ribonucleoprotein L (hnRNP-L), and similar proteins Back     alignment and domain information
>gnl|CDD|240825 cd12379, RRM2_I_PABPs, RNA recognition motif 2 found in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|241052 cd12608, RRM1_CoAA, RNA recognition motif 1 in vertebrate RRM-containing coactivator activator/modulator (CoAA) Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|240789 cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 and 2 in RRM-containing coactivator activator/modulator (CoAA) and similar proteins Back     alignment and domain information
>gnl|CDD|241050 cd12606, RRM1_RBM4, RNA recognition motif 1 in vertebrate RNA-binding protein 4 (RBM4) Back     alignment and domain information
>gnl|CDD|240761 cd12315, RRM1_RBM19_MRD1, RNA recognition motif 1 in RNA-binding protein 19 (RBM19), yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240743 cd12297, RRM2_Prp24, RNA recognition motif 2 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins Back     alignment and domain information
>gnl|CDD|240893 cd12447, RRM1_gar2, RNA recognition motif 1 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|241202 cd12758, RRM1_hnRPDL, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein D-like (hnRNP D-like or hnRNP DL) and similar proteins Back     alignment and domain information
>gnl|CDD|240679 cd12233, RRM_Srp1p_AtRSp31_like, RNA recognition motif found in fission yeast pre-mRNA-splicing factor Srp1p, Arabidopsis thaliana arginine/serine-rich-splicing factor RSp31 and similar proteins Back     alignment and domain information
>gnl|CDD|240767 cd12321, RRM1_TDP43, RNA recognition motif 1 in TAR DNA-binding protein 43 (TDP-43) and similar proteins Back     alignment and domain information
>gnl|CDD|240731 cd12285, RRM3_RBM39_like, RNA recognition motif 3 in vertebrate RNA-binding protein 39 (RBM39) and similar proteins Back     alignment and domain information
>gnl|CDD|240774 cd12328, RRM2_hnRNPA_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A subfamily Back     alignment and domain information
>gnl|CDD|241021 cd12577, RRM1_Hrp1p, RNA recognition motif 1 in yeast nuclear polyadenylated RNA-binding protein 4 (Hrp1p or Nab4p) and similar proteins Back     alignment and domain information
>gnl|CDD|240741 cd12295, RRM_YRA2, RNA recognition motif in yeast RNA annealing protein YRA2 (Yra2p) and similar proteins Back     alignment and domain information
>gnl|CDD|241036 cd12592, RRM_RBM7, RNA recognition motif in vertebrate RNA-binding protein 7 (RBM7) Back     alignment and domain information
>gnl|CDD|241131 cd12687, RRM1_PTBPH3, RNA recognition motif 1 in plant polypyrimidine tract-binding protein homolog 3 (PTBPH3) Back     alignment and domain information
>gnl|CDD|240782 cd12336, RRM_RBM7_like, RNA recognition motif in RNA-binding protein 7 (RBM7) and similar proteins Back     alignment and domain information
>gnl|CDD|240786 cd12340, RBD_RRM1_NPL3, RNA recognition motif 1 in yeast nucleolar protein 3 (Npl3p) and similar proteins Back     alignment and domain information
>gnl|CDD|240916 cd12472, RRM1_RBMS3, RNA recognition motif 1 found in vertebrate RNA-binding motif, single-stranded-interacting protein 3 (RBMS3) Back     alignment and domain information
>gnl|CDD|240783 cd12337, RRM1_SRSF4_like, RNA recognition motif 1 in serine/arginine-rich splicing factor 4 (SRSF4) and similar proteins Back     alignment and domain information
>gnl|CDD|240918 cd12474, RRM2_MSSP2, RNA recognition motif 2 found in vertebrate single-stranded DNA-binding protein MSSP-2 Back     alignment and domain information
>gnl|CDD|240850 cd12404, RRM2_NCL, RNA recognition motif 2 in vertebrate nucleolin Back     alignment and domain information
>gnl|CDD|240675 cd12229, RRM_G3BP, RNA recognition motif (RRM) in ras GTPase-activating protein-binding protein G3BP1, G3BP2 and similar proteins Back     alignment and domain information
>gnl|CDD|240926 cd12482, RRM1_hnRNPR, RNA recognition motif 1 in vertebrate heterogeneous nuclear ribonucleoprotein R (hnRNP R) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 247
KOG0122|consensus270 100.0
PF12353128 eIF3g: Eukaryotic translation initiation factor 3 100.0
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 99.78
TIGR01661352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 99.71
TIGR01661 352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 99.68
TIGR01659 346 sex-lethal sex-lethal family splicing factor. This 99.65
PF0007670 RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or 99.65
KOG0121|consensus153 99.62
KOG4207|consensus 256 99.6
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 99.56
PF1425970 RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or 99.56
TIGR01659346 sex-lethal sex-lethal family splicing factor. This 99.54
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 99.53
KOG0148|consensus 321 99.51
KOG0107|consensus 195 99.51
TIGR01628 562 PABP-1234 polyadenylate binding protein, human typ 99.51
PLN03120 260 nucleic acid binding protein; Provisional 99.49
KOG0149|consensus 247 99.49
KOG0113|consensus 335 99.49
TIGR01642 509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 99.48
PLN03213 759 repressor of silencing 3; Provisional 99.48
TIGR01622 457 SF-CC1 splicing factor, CC1-like family. A homolog 99.47
KOG0130|consensus170 99.47
KOG0145|consensus 360 99.47
COG0724 306 RNA-binding proteins (RRM domain) [General functio 99.46
TIGR01628 562 PABP-1234 polyadenylate binding protein, human typ 99.46
smart0036272 RRM_2 RNA recognition motif. 99.45
KOG0125|consensus 376 99.45
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 99.45
KOG0126|consensus 219 99.44
smart0036071 RRM RNA recognition motif. 99.43
TIGR01622 457 SF-CC1 splicing factor, CC1-like family. A homolog 99.43
KOG0111|consensus 298 99.43
KOG0145|consensus360 99.42
PLN03121 243 nucleic acid binding protein; Provisional 99.38
cd0059074 RRM RRM (RNA recognition motif), also known as RBD 99.38
KOG0131|consensus 203 99.37
KOG0148|consensus321 99.36
TIGR01649 481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 99.36
KOG0108|consensus 435 99.35
KOG0117|consensus 506 99.34
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 99.33
KOG0146|consensus371 99.31
smart0036170 RRM_1 RNA recognition motif. 99.3
KOG0114|consensus124 99.29
KOG0127|consensus 678 99.28
KOG0105|consensus 241 99.27
TIGR01649 481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 99.26
PF1389356 RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or 99.26
KOG0144|consensus 510 99.25
KOG0117|consensus 506 99.24
KOG0127|consensus 678 99.23
KOG0124|consensus 544 99.16
KOG0147|consensus 549 99.16
KOG0144|consensus 510 99.15
KOG4208|consensus214 99.11
KOG0415|consensus 479 99.1
KOG0131|consensus203 99.08
KOG0109|consensus 346 99.04
KOG0153|consensus377 98.98
KOG0123|consensus 369 98.97
KOG0123|consensus 369 98.95
KOG4661|consensus 940 98.94
KOG4206|consensus 221 98.94
TIGR01642 509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 98.93
KOG4212|consensus 608 98.91
KOG0132|consensus 894 98.88
KOG0124|consensus 544 98.86
KOG0146|consensus 371 98.86
KOG0109|consensus 346 98.84
KOG0533|consensus243 98.84
KOG0110|consensus725 98.83
KOG0151|consensus 877 98.83
KOG0110|consensus 725 98.77
KOG1457|consensus 284 98.76
KOG4205|consensus 311 98.76
PF0405997 RRM_2: RNA recognition motif 2; InterPro: IPR00720 98.65
KOG0226|consensus290 98.59
KOG4212|consensus608 98.57
KOG4209|consensus231 98.57
KOG4205|consensus 311 98.56
KOG1548|consensus 382 98.55
KOG0116|consensus419 98.47
KOG0106|consensus 216 98.41
KOG4660|consensus 549 98.32
KOG4454|consensus 267 98.28
KOG1190|consensus 492 98.2
KOG0120|consensus 500 98.17
KOG1995|consensus 351 98.07
KOG4211|consensus 510 98.04
KOG0147|consensus 549 97.91
KOG4210|consensus285 97.85
PF1160890 Limkain-b1: Limkain b1; InterPro: IPR024582 This e 97.7
KOG1457|consensus284 97.7
KOG4211|consensus 510 97.69
COG5175 480 MOT2 Transcriptional repressor [Transcription] 97.57
KOG4206|consensus221 97.55
KOG4849|consensus 498 97.53
PF08777105 RRM_3: RNA binding motif; InterPro: IPR014886 This 97.5
KOG3152|consensus 278 97.45
KOG0106|consensus216 97.36
KOG2314|consensus 698 97.31
KOG0105|consensus241 97.29
KOG4307|consensus944 97.27
PF1460553 Nup35_RRM_2: Nup53/35/40-type RNA recognition moti 97.24
KOG1456|consensus 494 97.21
PF05172100 Nup35_RRM: Nup53/35/40-type RNA recognition motif; 97.04
KOG1365|consensus 508 97.03
KOG1190|consensus492 96.92
KOG1548|consensus382 96.87
PF0867587 RNA_bind: RNA binding domain; InterPro: IPR014789 96.76
KOG0120|consensus500 96.5
KOG1456|consensus 494 96.47
KOG2193|consensus 584 96.36
PF08952146 DUF1866: Domain of unknown function (DUF1866) ; In 96.35
KOG2202|consensus 260 96.03
KOG0128|consensus881 96.01
KOG2416|consensus 718 96.0
KOG0129|consensus 520 95.8
KOG0128|consensus 881 95.75
KOG4307|consensus 944 95.55
KOG1365|consensus 508 95.49
KOG1855|consensus 484 95.47
KOG0129|consensus520 95.41
KOG0112|consensus 975 95.25
KOG2068|consensus 327 95.19
PF03467176 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 94.83
KOG2135|consensus526 94.71
PF1030962 DUF2414: Protein of unknown function (DUF2414); In 94.71
KOG0115|consensus 275 94.7
KOG4676|consensus 479 93.82
KOG1996|consensus378 93.78
PF07576110 BRAP2: BRCA1-associated protein 2; InterPro: IPR01 93.25
KOG4660|consensus549 92.92
KOG2253|consensus 668 92.43
PF0388074 DbpA: DbpA RNA binding domain ; InterPro: IPR00558 92.3
PF15023166 DUF4523: Protein of unknown function (DUF4523) 91.97
PF1369632 zf-CCHC_2: Zinc knuckle 91.9
PF04847 184 Calcipressin: Calcipressin; InterPro: IPR006931 Ca 91.88
KOG4285|consensus350 91.59
KOG0112|consensus 975 90.95
KOG4210|consensus 285 89.47
PF0009818 zf-CCHC: Zinc knuckle; InterPro: IPR001878 Zinc fi 89.02
PF1391742 zf-CCHC_3: Zinc knuckle 88.58
KOG0804|consensus 493 84.65
PF1176766 SET_assoc: Histone lysine methyltransferase SET as 84.53
>KOG0122|consensus Back     alignment and domain information
Probab=100.00  E-value=6.6e-69  Score=460.86  Aligned_cols=224  Identities=43%  Similarity=0.775  Sum_probs=189.8

Q ss_pred             ceeeEEEEEEEEEEEeChhHHhhcCCcccccccCCCCCCCCCCeeecceEEEEeecCccccccch--hHhhhccc--eee
Q psy13227          4 ESTKVVRTLKVEKKLVSKGIALRKHLAKYGKSANDKPGPQSNTTIIGEEVHIQFISNKEEVEKPE--EENLEKLK--FIS   79 (247)
Q Consensus         4 ~k~k~~~~~~~~~~~v~~~va~Rk~w~kfg~~~~~~~g~~~~tt~~~e~v~~~~~~~~~~~~~~~--~~~~~~~~--~~~   79 (247)
                      +||||||+|||+|+.|+|+||+||+|.|||++++++|||+..||.++|||.|+|+++|+.+++++  ++...++.  +++
T Consensus        42 kK~Kvt~~~kv~k~~v~K~vaeRknW~KFG~~~~~~~Gp~~~Tt~v~EeI~l~~~~~~~~~~~~~~~~d~~s~~g~~~~~  121 (270)
T KOG0122|consen   42 KKVKVTRTFKVEKRAVPKAVAERKNWVKFGDSKGEPAGPSVATTRVTEEIELRFIRSPTFEEEQDIQEDKASKLGKSIVA  121 (270)
T ss_pred             cEEEEEEEEEEEEEeccHHHHhhccchhhccccCCCCCCceeeEecccceeEEeccCcccchhhhhhhcchhhcccceee
Confidence            79999999999999999999999999999999999999999999999999999999996544332  22333332  899


Q ss_pred             eeeccCCccccCCCCccchhh-hhhcCCCCCCCCCCccccccCCCCCCCCCCCCCCCCCccccCCCCCCCCCCCCcCCCc
Q psy13227         80 CRTCKGAHFTNNCPFKDSALF-LADANKKPFNTVPGTNIMAASSDDKKSGGPGGAPGGPAIYVPPSLREGPGGKRVEGYN  158 (247)
Q Consensus        80 Cr~C~g~h~t~~CP~k~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~yvpp~~r~~~~~~~~~~~~  158 (247)
                      ||+|+|||||++||||+++.+ ++         +|+...       .++... ..++..|.||||++|.++.+.+| ++ 
T Consensus       122 CR~C~gdHwt~~CPyK~~~~~~ld---------e~~~~e-------~~~~~~-ap~~~~g~yvpP~mR~ga~~~~g-~~-  182 (270)
T KOG0122|consen  122 CRICKGDHWTTNCPYKDTLSPALD---------EPATAE-------SPAESA-APGTKKGKYVPPSMRAGADRASG-SD-  182 (270)
T ss_pred             eeecCCCeeeecCCchhhcccccc---------CCcccc-------cchhhc-CcCCcCccccCccccCCcccccc-cc-
Confidence            999999999999999999875 22         111100       001111 11677899999999999333334 32 


Q ss_pred             ccCCCCccEEEEeecCCCCCHHHHHHHhhccCCeeEEEEeecCCCCceeeEEEEEecCHHHHHHHHHHhcCceeCCeEEE
Q psy13227        159 ARRNDDTTAIRISNLSVNTSENDLEDLVKQFGPTSKMYLSRDKTNGLCKGFAYIHFKNKADAAKAIQYLNGYGYDHLILS  238 (247)
Q Consensus       159 ~~~~~~~~tl~V~nLp~~~te~dL~~lF~~fG~I~~i~l~~d~~tg~skGfaFV~F~s~e~A~~Ai~~LnG~~i~g~~L~  238 (247)
                      .|.|+|.++|+|+|||++++|++|++||.+||.|.+++|++|++||.++|||||+|.++++|++||..|||+.|++++|+
T Consensus       183 ~R~R~D~~tvRvtNLsed~~E~dL~eLf~~fg~i~rvylardK~TG~~kGFAFVtF~sRddA~rAI~~LnG~gyd~LILr  262 (270)
T KOG0122|consen  183 MRERDDEATVRVTNLSEDMREDDLEELFRPFGPITRVYLARDKETGLSKGFAFVTFESRDDAARAIADLNGYGYDNLILR  262 (270)
T ss_pred             cccCCccceeEEecCccccChhHHHHHhhccCccceeEEEEccccCcccceEEEEEecHHHHHHHHHHccCcccceEEEE
Confidence            36788999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EeecCCCC
Q psy13227        239 VDWSKSTN  246 (247)
Q Consensus       239 V~~akp~~  246 (247)
                      |+|++|++
T Consensus       263 vEwskP~~  270 (270)
T KOG0122|consen  263 VEWSKPSN  270 (270)
T ss_pred             EEecCCCC
Confidence            99999975



>PF12353 eIF3g: Eukaryotic translation initiation factor 3 subunit G ; InterPro: IPR024675 At least eleven different protein factors are involved in initiation of protein synthesis in eukaryotes Back     alignment and domain information
>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>PF00076 RRM_1: RNA recognition motif Back     alignment and domain information
>KOG0121|consensus Back     alignment and domain information
>KOG4207|consensus Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>PF14259 RRM_6: RNA recognition motif (a Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>KOG0148|consensus Back     alignment and domain information
>KOG0107|consensus Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>PLN03120 nucleic acid binding protein; Provisional Back     alignment and domain information
>KOG0149|consensus Back     alignment and domain information
>KOG0113|consensus Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>PLN03213 repressor of silencing 3; Provisional Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>KOG0130|consensus Back     alignment and domain information
>KOG0145|consensus Back     alignment and domain information
>COG0724 RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>smart00362 RRM_2 RNA recognition motif Back     alignment and domain information
>KOG0125|consensus Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>KOG0126|consensus Back     alignment and domain information
>smart00360 RRM RNA recognition motif Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>KOG0111|consensus Back     alignment and domain information
>KOG0145|consensus Back     alignment and domain information
>PLN03121 nucleic acid binding protein; Provisional Back     alignment and domain information
>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability Back     alignment and domain information
>KOG0131|consensus Back     alignment and domain information
>KOG0148|consensus Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>KOG0108|consensus Back     alignment and domain information
>KOG0117|consensus Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>KOG0146|consensus Back     alignment and domain information
>smart00361 RRM_1 RNA recognition motif Back     alignment and domain information
>KOG0114|consensus Back     alignment and domain information
>KOG0127|consensus Back     alignment and domain information
>KOG0105|consensus Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>PF13893 RRM_5: RNA recognition motif Back     alignment and domain information
>KOG0144|consensus Back     alignment and domain information
>KOG0117|consensus Back     alignment and domain information
>KOG0127|consensus Back     alignment and domain information
>KOG0124|consensus Back     alignment and domain information
>KOG0147|consensus Back     alignment and domain information
>KOG0144|consensus Back     alignment and domain information
>KOG4208|consensus Back     alignment and domain information
>KOG0415|consensus Back     alignment and domain information
>KOG0131|consensus Back     alignment and domain information
>KOG0109|consensus Back     alignment and domain information
>KOG0153|consensus Back     alignment and domain information
>KOG0123|consensus Back     alignment and domain information
>KOG0123|consensus Back     alignment and domain information
>KOG4661|consensus Back     alignment and domain information
>KOG4206|consensus Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>KOG4212|consensus Back     alignment and domain information
>KOG0132|consensus Back     alignment and domain information
>KOG0124|consensus Back     alignment and domain information
>KOG0146|consensus Back     alignment and domain information
>KOG0109|consensus Back     alignment and domain information
>KOG0533|consensus Back     alignment and domain information
>KOG0110|consensus Back     alignment and domain information
>KOG0151|consensus Back     alignment and domain information
>KOG0110|consensus Back     alignment and domain information
>KOG1457|consensus Back     alignment and domain information
>KOG4205|consensus Back     alignment and domain information
>PF04059 RRM_2: RNA recognition motif 2; InterPro: IPR007201 This RNA recognition motif 2 is found in Meiosis protein mei2 Back     alignment and domain information
>KOG0226|consensus Back     alignment and domain information
>KOG4212|consensus Back     alignment and domain information
>KOG4209|consensus Back     alignment and domain information
>KOG4205|consensus Back     alignment and domain information
>KOG1548|consensus Back     alignment and domain information
>KOG0116|consensus Back     alignment and domain information
>KOG0106|consensus Back     alignment and domain information
>KOG4660|consensus Back     alignment and domain information
>KOG4454|consensus Back     alignment and domain information
>KOG1190|consensus Back     alignment and domain information
>KOG0120|consensus Back     alignment and domain information
>KOG1995|consensus Back     alignment and domain information
>KOG4211|consensus Back     alignment and domain information
>KOG0147|consensus Back     alignment and domain information
>KOG4210|consensus Back     alignment and domain information
>PF11608 Limkain-b1: Limkain b1; InterPro: IPR024582 This entry represents a conserved domain found in limkain b1, which is a novel human autoantigen, localised to a subset of ABCD3 and PXF marked peroxisomes Back     alignment and domain information
>KOG1457|consensus Back     alignment and domain information
>KOG4211|consensus Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>KOG4206|consensus Back     alignment and domain information
>KOG4849|consensus Back     alignment and domain information
>PF08777 RRM_3: RNA binding motif; InterPro: IPR014886 This domain is found in protein La which functions as an RNA chaperone during RNA polymerase III transcription, and can also stimulate translation initiation Back     alignment and domain information
>KOG3152|consensus Back     alignment and domain information
>KOG0106|consensus Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>KOG0105|consensus Back     alignment and domain information
>KOG4307|consensus Back     alignment and domain information
>PF14605 Nup35_RRM_2: Nup53/35/40-type RNA recognition motif Back     alignment and domain information
>KOG1456|consensus Back     alignment and domain information
>PF05172 Nup35_RRM: Nup53/35/40-type RNA recognition motif; InterPro: IPR007846 The MPPN (Mitotic PhosphoProtein N end) family is uncharacterised however it probably plays a role in the cell cycle because the family includes mitotic phosphoproteins O13026 from SWISSPROT [] Back     alignment and domain information
>KOG1365|consensus Back     alignment and domain information
>KOG1190|consensus Back     alignment and domain information
>KOG1548|consensus Back     alignment and domain information
>PF08675 RNA_bind: RNA binding domain; InterPro: IPR014789 This domain corresponds to the RNA binding domain of Poly(A)-specific ribonuclease (PARN) Back     alignment and domain information
>KOG0120|consensus Back     alignment and domain information
>KOG1456|consensus Back     alignment and domain information
>KOG2193|consensus Back     alignment and domain information
>PF08952 DUF1866: Domain of unknown function (DUF1866) ; InterPro: IPR015047 This domain, found in synaptojanin, has no known function Back     alignment and domain information
>KOG2202|consensus Back     alignment and domain information
>KOG0128|consensus Back     alignment and domain information
>KOG2416|consensus Back     alignment and domain information
>KOG0129|consensus Back     alignment and domain information
>KOG0128|consensus Back     alignment and domain information
>KOG4307|consensus Back     alignment and domain information
>KOG1365|consensus Back     alignment and domain information
>KOG1855|consensus Back     alignment and domain information
>KOG0129|consensus Back     alignment and domain information
>KOG0112|consensus Back     alignment and domain information
>KOG2068|consensus Back     alignment and domain information
>PF03467 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 Nonsense-mediated mRNA decay (NMD) is a surveillance mechanism by which eukaryotic cells detect and degrade transcripts containing premature termination codons Back     alignment and domain information
>KOG2135|consensus Back     alignment and domain information
>PF10309 DUF2414: Protein of unknown function (DUF2414); InterPro: IPR019416 This entry contains proteins that have no known function Back     alignment and domain information
>KOG0115|consensus Back     alignment and domain information
>KOG4676|consensus Back     alignment and domain information
>KOG1996|consensus Back     alignment and domain information
>PF07576 BRAP2: BRCA1-associated protein 2; InterPro: IPR011422 These proteins include BRCA1-associated protein 2 (BRAP2), which binds nuclear localisation signals (NLSs) in vitro and in yeast two-hybrid screening [] Back     alignment and domain information
>KOG4660|consensus Back     alignment and domain information
>KOG2253|consensus Back     alignment and domain information
>PF03880 DbpA: DbpA RNA binding domain ; InterPro: IPR005580 This RNA binding domain is found at the C terminus of a number of DEAD helicase proteins [] Back     alignment and domain information
>PF15023 DUF4523: Protein of unknown function (DUF4523) Back     alignment and domain information
>PF13696 zf-CCHC_2: Zinc knuckle Back     alignment and domain information
>PF04847 Calcipressin: Calcipressin; InterPro: IPR006931 Calcipressin 1 negatively regulates calcineurin (IPR015757 from INTERPRO) by direct binding and is essential for the survival of T helper type 1 cells Back     alignment and domain information
>KOG4285|consensus Back     alignment and domain information
>KOG0112|consensus Back     alignment and domain information
>KOG4210|consensus Back     alignment and domain information
>PF00098 zf-CCHC: Zinc knuckle; InterPro: IPR001878 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13917 zf-CCHC_3: Zinc knuckle Back     alignment and domain information
>KOG0804|consensus Back     alignment and domain information
>PF11767 SET_assoc: Histone lysine methyltransferase SET associated; InterPro: IPR024636 The SET domain is a protein-protein interaction domain found in protein lysine methyltransferase enzymes Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query247
2cq0_A103 Solution Structure Of Rna Binding Domain In Eukaryo 2e-23
1h6k_Z98 Nuclear Cap Binding Complex Length = 98 4e-07
2rrb_A96 Refinement Of Rna Binding Domain In Human Tra2 Beta 5e-07
2kxn_B129 Nmr Structure Of Human Tra2beta1 Rrm In Complex Wit 5e-07
2rra_A99 Solution Structure Of Rna Binding Domain In Human T 6e-07
2lea_A135 Solution Structure Of Human Srsf2 (Sc35) Rrm Length 9e-07
1h2t_Z156 Structure Of The Human Nuclear Cap-Binding-Complex 1e-06
2kn4_A158 The Structure Of The Rrm Domain Of Sc35 Length = 15 2e-06
1x5s_A102 Solution Structure Of Rrm Domain In A18 Hnrnp Lengt 6e-06
4egl_A177 Crystal Structure Of Two Tandem Rna Recognition Mot 2e-05
4ed5_A177 Crystal Structure Of The Two N-Terminal Rrm Domains 2e-05
2cqc_A95 Solution Structure Of The Rna Recognition Motif In 2e-05
1whw_A99 Solution Structure Of The N-Terminal Rna Binding Do 3e-05
2fy1_A116 A Dual Mode Of Rna Recognition By The Rbmy Protein 3e-05
1no8_A106 Solution Structure Of The Nuclear Factor Aly Rbd Do 4e-05
2km8_B84 Interdomain Rrm Packing Contributes To Rna Recognit 5e-05
3ulh_A107 Crystal Structure Of A Rna Binding Domain Of Tho Co 8e-05
2x1f_A96 Structure Of Rna15 Rrm With Bound Rna (Gu) Length = 8e-05
2x1a_A97 Structure Of Rna15 Rrm With Rna Bound (G) Length = 1e-04
1p1t_A104 Nmr Structure Of The N-Terminal Rrm Domain Of Cleav 1e-04
2dnm_A103 Solution Structure Of Rna Binding Domain In Srp46 S 2e-04
2f3j_A177 The Solution Structure Of The Ref2-I Mrna Export Fa 2e-04
2hyi_B91 Structure Of The Human Exon Junction Complex With A 2e-04
1p27_B106 Crystal Structure Of The Human Y14MAGOH COMPLEX Len 2e-04
2xb2_D90 Crystal Structure Of The Core Mago-Y14-Eif4aiii-Bar 2e-04
2dnz_A95 Solution Structure Of The Second Rna Binding Domain 2e-04
2j0s_D89 The Crystal Structure Of The Exon Junction Complex 2e-04
1b7f_A168 Sxl-Lethal ProteinRNA COMPLEX Length = 168 2e-04
3ex7_B126 The Crystal Structure Of Ejc In Its Transition Stat 3e-04
2yka_A124 Rrm Domain Of Mrna Export Adaptor Ref2-I Bound To H 3e-04
2kt5_A124 Rrm Domain Of Mrna Export Adaptor Ref2-I Bound To H 3e-04
2j0q_D109 The Crystal Structure Of The Exon Junction Complex 3e-04
2sxl_A88 Sex-Lethal Rbd1, Nmr, Minimized Average Structure L 3e-04
3s7r_A87 Crystal Structure Of A Heterogeneous Nuclear Ribonu 4e-04
2dgo_A115 Solution Structure Of The Rna Binding Domain In Cyt 5e-04
2jrs_A108 Solution Nmr Structure Of Caper Rrm2 Domain. Northe 5e-04
3sxl_A184 Sex-Lethal Rna Recognition Domains 1 And 2 From Dro 6e-04
2cpx_A115 Solution Structure Of Rna Binding Domain In Hypothe 7e-04
1d9a_A85 Solution Structure Of The Second Rna-Binding Domain 8e-04
2dh7_A105 Solution Structure Of The Second Rna Binding Domain 8e-04
1fnx_H174 Solution Structure Of The Huc Rbd1-Rbd2 Complexed W 9e-04
>pdb|2CQ0|A Chain A, Solution Structure Of Rna Binding Domain In Eukaryotic Translation Initiation Factor 3 Subunit 4 Length = 103 Back     alignment and structure

Iteration: 1

Score = 105 bits (263), Expect = 2e-23, Method: Compositional matrix adjust. Identities = 48/88 (54%), Positives = 67/88 (76%), Gaps = 1/88 (1%) Query: 160 RRNDDTTAIRISNLSVNTSENDLEDLVKQFGPTSKMYLSRDKTNGLCKGFAYIHFKNKAD 219 RR DD IR++NLS +T E DL++L + FG S++YL++DKT G KGFA+I F + D Sbjct: 10 RRADDNATIRVTNLSEDTRETDLQELFRPFGSISRIYLAKDKTTGQSKGFAFISFHRRED 69 Query: 220 AAKAIQYLNGYGYDHLILSVDWSK-STN 246 AA+AI ++G+GYDHLIL+V+W+K STN Sbjct: 70 AARAIAGVSGFGYDHLILNVEWAKPSTN 97
>pdb|1H6K|Z Chain Z, Nuclear Cap Binding Complex Length = 98 Back     alignment and structure
>pdb|2RRB|A Chain A, Refinement Of Rna Binding Domain In Human Tra2 Beta Protein Length = 96 Back     alignment and structure
>pdb|2KXN|B Chain B, Nmr Structure Of Human Tra2beta1 Rrm In Complex With Aagaac Rna Length = 129 Back     alignment and structure
>pdb|2RRA|A Chain A, Solution Structure Of Rna Binding Domain In Human Tra2 Beta Protein In Complex With Rna (Gaagaa) Length = 99 Back     alignment and structure
>pdb|2LEA|A Chain A, Solution Structure Of Human Srsf2 (Sc35) Rrm Length = 135 Back     alignment and structure
>pdb|1H2T|Z Chain Z, Structure Of The Human Nuclear Cap-Binding-Complex (Cbc) In Complex With A Cap Analogue M7gpppg Length = 156 Back     alignment and structure
>pdb|2KN4|A Chain A, The Structure Of The Rrm Domain Of Sc35 Length = 158 Back     alignment and structure
>pdb|1X5S|A Chain A, Solution Structure Of Rrm Domain In A18 Hnrnp Length = 102 Back     alignment and structure
>pdb|4EGL|A Chain A, Crystal Structure Of Two Tandem Rna Recognition Motifs Of Human Antigen R Length = 177 Back     alignment and structure
>pdb|4ED5|A Chain A, Crystal Structure Of The Two N-Terminal Rrm Domains Of Hur Complexed With Rna Length = 177 Back     alignment and structure
>pdb|2CQC|A Chain A, Solution Structure Of The Rna Recognition Motif In ArginineSERINE-Rich Splicing Factor 10 Length = 95 Back     alignment and structure
>pdb|1WHW|A Chain A, Solution Structure Of The N-Terminal Rna Binding Domain From Hypothetical Protein Bab23448 Length = 99 Back     alignment and structure
>pdb|2FY1|A Chain A, A Dual Mode Of Rna Recognition By The Rbmy Protein Length = 116 Back     alignment and structure
>pdb|1NO8|A Chain A, Solution Structure Of The Nuclear Factor Aly Rbd Domain Length = 106 Back     alignment and structure
>pdb|2KM8|B Chain B, Interdomain Rrm Packing Contributes To Rna Recognition In The Rna15, Hrp1, Anchor Rna 3' Processing Ternary Complex Length = 84 Back     alignment and structure
>pdb|3ULH|A Chain A, Crystal Structure Of A Rna Binding Domain Of Tho Complex Subunit 4 Protein (Thoc4) From Homo Sapiens At 2.54 A Resolution Length = 107 Back     alignment and structure
>pdb|2X1F|A Chain A, Structure Of Rna15 Rrm With Bound Rna (Gu) Length = 96 Back     alignment and structure
>pdb|2X1A|A Chain A, Structure Of Rna15 Rrm With Rna Bound (G) Length = 97 Back     alignment and structure
>pdb|1P1T|A Chain A, Nmr Structure Of The N-Terminal Rrm Domain Of Cleavage Stimulation Factor 64 Kda Subunit Length = 104 Back     alignment and structure
>pdb|2DNM|A Chain A, Solution Structure Of Rna Binding Domain In Srp46 Splicing Factor Length = 103 Back     alignment and structure
>pdb|2F3J|A Chain A, The Solution Structure Of The Ref2-I Mrna Export Factor (Residues 1-155) Length = 177 Back     alignment and structure
>pdb|2HYI|B Chain B, Structure Of The Human Exon Junction Complex With A Trapped Dead-Box Helicase Bound To Rna Length = 91 Back     alignment and structure
>pdb|1P27|B Chain B, Crystal Structure Of The Human Y14MAGOH COMPLEX Length = 106 Back     alignment and structure
>pdb|2XB2|D Chain D, Crystal Structure Of The Core Mago-Y14-Eif4aiii-Barentsz- Upf3b Assembly Shows How The Ejc Is Bridged To The Nmd Machinery Length = 90 Back     alignment and structure
>pdb|2DNZ|A Chain A, Solution Structure Of The Second Rna Binding Domain Of Rna Binding Motif Protein 23 Length = 95 Back     alignment and structure
>pdb|2J0S|D Chain D, The Crystal Structure Of The Exon Junction Complex At 2.2 A Resolution Length = 89 Back     alignment and structure
>pdb|1B7F|A Chain A, Sxl-Lethal ProteinRNA COMPLEX Length = 168 Back     alignment and structure
>pdb|3EX7|B Chain B, The Crystal Structure Of Ejc In Its Transition State Length = 126 Back     alignment and structure
>pdb|2YKA|A Chain A, Rrm Domain Of Mrna Export Adaptor Ref2-I Bound To Hvs Orf57 Peptide Length = 124 Back     alignment and structure
>pdb|2KT5|A Chain A, Rrm Domain Of Mrna Export Adaptor Ref2-I Bound To Hsv-1 Icp27 Peptide Length = 124 Back     alignment and structure
>pdb|2J0Q|D Chain D, The Crystal Structure Of The Exon Junction Complex At 3.2 A Resolution Length = 109 Back     alignment and structure
>pdb|2SXL|A Chain A, Sex-Lethal Rbd1, Nmr, Minimized Average Structure Length = 88 Back     alignment and structure
>pdb|3S7R|A Chain A, Crystal Structure Of A Heterogeneous Nuclear Ribonucleoprotein AB (Hnrpab) From Homo Sapiens At 2.15 A Resolution Length = 87 Back     alignment and structure
>pdb|2DGO|A Chain A, Solution Structure Of The Rna Binding Domain In Cytotoxic Granule-Associated Rna Binding Protein 1 Length = 115 Back     alignment and structure
>pdb|2JRS|A Chain A, Solution Nmr Structure Of Caper Rrm2 Domain. Northeast Structural Genomics Target Hr4730a Length = 108 Back     alignment and structure
>pdb|3SXL|A Chain A, Sex-Lethal Rna Recognition Domains 1 And 2 From Drosophila Melanogaster Length = 184 Back     alignment and structure
>pdb|2CPX|A Chain A, Solution Structure Of Rna Binding Domain In Hypothetical Protein Flj11016 Length = 115 Back     alignment and structure
>pdb|1D9A|A Chain A, Solution Structure Of The Second Rna-Binding Domain (Rbd2) Of Hu Antigen C (Huc) Length = 85 Back     alignment and structure
>pdb|2DH7|A Chain A, Solution Structure Of The Second Rna Binding Domain In Nucleolysin Tiar Length = 105 Back     alignment and structure
>pdb|1FNX|H Chain H, Solution Structure Of The Huc Rbd1-Rbd2 Complexed With The Au-Rich Element Length = 174 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query247
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 5e-32
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 1e-21
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 4e-21
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 1e-17
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 3e-17
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 6e-17
2f3j_A177 RNA and export factor binding protein 2; RRM domai 1e-16
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} Len 1e-16
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 2e-16
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 2e-16
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 7e-16
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 1e-15
3q2s_C229 Cleavage and polyadenylation specificity factor S; 1e-15
3smz_A 284 Protein raver-1, ribonucleoprotein PTB-binding 1; 2e-15
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 4e-11
3smz_A 284 Protein raver-1, ribonucleoprotein PTB-binding 1; 3e-09
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 5e-15
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 6e-15
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 4e-11
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 6e-15
1x4e_A85 RNA binding motif, single-stranded interacting pro 7e-15
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 8e-15
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 2e-14
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 2e-14
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 2e-14
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 2e-14
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 3e-14
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 3e-14
2i2y_A150 Fusion protein consists of immunoglobin G- binding 4e-14
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 4e-14
2kt5_A124 RNA and export factor-binding protein 2; chaperone 5e-14
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 6e-14
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 6e-14
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 9e-14
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 6e-12
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 1e-13
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 2e-13
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 2e-13
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 2e-13
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 2e-13
2qfj_A 216 FBP-interacting repressor; protein-DNA complex; HE 3e-13
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 2e-11
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 4e-13
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 4e-13
2cpj_A99 Non-POU domain-containing octamer-binding protein; 4e-13
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 5e-13
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 5e-13
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 7e-13
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 7e-13
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 5e-11
2la6_A99 RNA-binding protein FUS; structural genomics, nort 1e-12
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 1e-12
3n9u_C156 Cleavage and polyadenylation specificity factor S; 1e-12
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 2e-12
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 2e-12
2cph_A107 RNA binding motif protein 19; RNA recognition moti 2e-12
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 2e-12
2ghp_A 292 U4/U6 snRNA-associated splicing factor PRP24; RNA 3e-11
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 5e-10
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 2e-12
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 2e-12
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 2e-12
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 3e-12
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 3e-12
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 3e-12
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 3e-12
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 4e-12
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 4e-12
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 4e-12
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 6e-12
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 6e-12
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 6e-12
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 6e-12
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 7e-12
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 7e-12
2yh0_A 198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 5e-09
3p5t_L90 Cleavage and polyadenylation specificity factor S; 8e-12
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 9e-12
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 9e-12
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 1e-11
4f02_A 213 Polyadenylate-binding protein 1; mRNA, eukaryotic 1e-11
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 3e-07
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 1e-11
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 1e-11
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 2e-11
3sde_A 261 Paraspeckle component 1; RRM, anti parallel right 3e-11
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 2e-11
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 2e-11
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 2e-09
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 2e-11
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 2e-11
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 3e-11
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 3e-11
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 3e-11
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 2e-08
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 3e-11
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 3e-11
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 3e-11
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 4e-11
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 4e-11
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 4e-11
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 5e-11
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 5e-11
2div_A99 TRNA selenocysteine associated protein; structural 5e-11
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 7e-11
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 1e-10
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 2e-10
3tyt_A 205 Heterogeneous nuclear ribonucleoprotein L; ferredo 6e-08
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 2e-10
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 2e-10
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 2e-10
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 2e-10
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 2e-10
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 3e-10
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 3e-10
1x5o_A114 RNA binding motif, single-stranded interacting pro 4e-10
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 7e-10
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 7e-10
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 7e-10
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 8e-10
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 8e-10
2adc_A 229 Polypyrimidine tract-binding protein 1; RBD, RRM, 2e-07
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 9e-10
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 1e-09
1qm9_A 198 Polypyrimidine tract-binding protein; ribonucleopr 1e-07
3pgw_S 437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 1e-09
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 1e-09
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 1e-09
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 2e-09
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 2e-09
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 2e-09
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 2e-09
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 3e-09
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 3e-09
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 3e-09
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 3e-09
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 3e-09
2dis_A109 Unnamed protein product; structural genomics, RRM 4e-09
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 5e-09
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 5e-09
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 7e-09
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 8e-09
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 1e-08
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 1e-08
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 2e-08
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 2e-08
2krb_A81 Eukaryotic translation initiation factor 3 subunit 2e-08
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 3e-08
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 3e-08
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 3e-08
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 3e-08
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 4e-08
1x5p_A97 Negative elongation factor E; structure genomics, 4e-08
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 4e-08
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 5e-08
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 5e-08
3pgw_A 282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 6e-08
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 6e-07
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 1e-07
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 2e-07
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 5e-07
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 7e-07
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 1e-06
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 8e-07
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 1e-06
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 1e-06
1l3k_A 196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 1e-05
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 1e-06
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 2e-06
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 3e-06
2cqd_A116 RNA-binding region containing protein 1; RNA recog 7e-06
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 9e-06
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 1e-05
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 2e-05
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 3e-05
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 3e-05
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 3e-05
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 4e-05
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 4e-05
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 5e-05
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 9e-05
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 1e-04
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 1e-04
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 2e-04
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 3e-04
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 5e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-04
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 6e-04
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 7e-04
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
 Score =  112 bits (282), Expect = 5e-32
 Identities = 45/84 (53%), Positives = 64/84 (76%)

Query: 160 RRNDDTTAIRISNLSVNTSENDLEDLVKQFGPTSKMYLSRDKTNGLCKGFAYIHFKNKAD 219
           RR DD   IR++NLS +T E DL++L + FG  S++YL++DKT G  KGFA+I F  + D
Sbjct: 10  RRADDNATIRVTNLSEDTRETDLQELFRPFGSISRIYLAKDKTTGQSKGFAFISFHRRED 69

Query: 220 AAKAIQYLNGYGYDHLILSVDWSK 243
           AA+AI  ++G+GYDHLIL+V+W+K
Sbjct: 70  AARAIAGVSGFGYDHLILNVEWAK 93


>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Length = 135 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Length = 156 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Length = 158 Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Length = 177 Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Length = 129 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Length = 110 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 95 Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Length = 229 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Length = 165 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 85 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Length = 126 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Length = 110 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Length = 106 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 115 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Length = 150 Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Length = 124 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Length = 101 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Length = 88 Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 102 Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Length = 95 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 113 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Length = 106 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Length = 140 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Length = 107 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Length = 96 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Length = 156 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 107 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ALT splicing, mRNA processing, mRNA splicing; 1.85A {Homo sapiens} PDB: 2kyx_A 3lpy_A* Length = 85 Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Length = 100 Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Length = 95 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Length = 118 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Length = 139 Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Length = 90 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Length = 108 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 93 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Length = 89 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} PDB: 2f9d_A 2f9j_A 2fho_B Length = 115 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Length = 124 Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 97 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Length = 115 Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Length = 115 Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Length = 126 Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Length = 105 Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Length = 88 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Length = 92 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Length = 103 Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Length = 87 Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} Length = 83 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Length = 97 Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Length = 139 Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Length = 110 Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Length = 115 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Length = 115 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Length = 100 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Length = 90 Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 108 Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Length = 111 Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Length = 96 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Length = 127 Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 124 Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 103 Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Length = 143 Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Length = 102 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Length = 97 Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 109 Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Length = 136 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Length = 193 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 119 Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196 Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 118 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Length = 107 Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Length = 75 Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Length = 87 Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Length = 104 Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Length = 164 Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Length = 109 Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Length = 130 Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 88 Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Length = 75 Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Length = 89 Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Length = 87 Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 112 Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Length = 77 Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query247
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 99.88
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 99.85
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.84
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 99.84
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 99.84
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 99.83
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 99.83
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 99.83
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 99.83
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 99.83
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 99.82
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 99.82
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 99.82
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 99.82
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 99.82
3p5t_L90 Cleavage and polyadenylation specificity factor S; 99.82
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 99.82
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 99.82
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 99.82
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 99.81
2cph_A107 RNA binding motif protein 19; RNA recognition moti 99.81
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 99.81
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 99.81
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 99.81
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 99.81
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 99.81
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 99.81
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 99.81
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 99.81
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 99.81
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 99.8
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 99.8
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 99.8
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 99.8
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 99.8
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 99.8
2div_A99 TRNA selenocysteine associated protein; structural 99.8
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 99.8
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 99.8
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 99.8
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 99.8
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 99.8
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 99.8
2la6_A99 RNA-binding protein FUS; structural genomics, nort 99.8
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 99.8
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 99.8
2cqd_A116 RNA-binding region containing protein 1; RNA recog 99.79
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 99.79
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 99.79
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.79
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 99.79
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 99.79
3n9u_C156 Cleavage and polyadenylation specificity factor S; 99.79
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 99.79
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 99.79
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 99.78
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 99.78
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 99.78
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 99.78
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 99.78
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 99.78
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.78
1x5o_A114 RNA binding motif, single-stranded interacting pro 99.78
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 99.78
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 99.78
2kt5_A124 RNA and export factor-binding protein 2; chaperone 99.78
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 99.78
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 99.78
2dis_A109 Unnamed protein product; structural genomics, RRM 99.77
2m2b_A131 RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio 99.77
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 99.77
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 99.77
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 99.77
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 99.77
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 99.77
1x4e_A85 RNA binding motif, single-stranded interacting pro 99.77
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 99.77
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 99.77
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 99.77
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 99.76
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 99.76
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 99.76
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 99.76
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 99.76
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 99.76
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 99.76
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 99.75
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 99.75
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 99.75
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 99.75
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 99.74
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 99.74
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 99.74
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 99.74
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 99.73
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 99.73
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 99.73
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.73
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 99.73
2cpj_A99 Non-POU domain-containing octamer-binding protein; 99.73
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 99.73
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 99.73
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 99.73
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 99.73
3q2s_C229 Cleavage and polyadenylation specificity factor S; 99.73
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.73
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 99.73
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 99.73
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 99.72
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 99.72
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 99.56
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 99.72
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 99.72
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 99.72
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 99.72
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 99.72
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.71
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 99.71
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 99.71
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 99.71
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 99.71
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 99.71
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 99.71
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 99.71
4f02_A 213 Polyadenylate-binding protein 1; mRNA, eukaryotic 99.71
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 99.71
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.71
2krb_A81 Eukaryotic translation initiation factor 3 subunit 99.71
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 99.7
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 99.7
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 99.7
1x5p_A97 Negative elongation factor E; structure genomics, 99.7
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 99.7
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 99.7
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 99.7
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 99.7
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 99.7
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 99.7
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 99.7
2i2y_A150 Fusion protein consists of immunoglobin G- binding 99.7
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 99.69
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 99.69
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 99.69
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 99.69
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 99.69
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 99.68
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 99.68
2f3j_A177 RNA and export factor binding protein 2; RRM domai 99.68
1l3k_A 196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 99.67
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 99.67
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 99.67
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.67
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.67
3pgw_S 437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 99.66
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 99.66
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 99.66
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 99.66
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 99.66
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 99.65
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 99.65
2j8a_A136 Histone-lysine N-methyltransferase, H3 lysine-4 sp 99.65
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 99.65
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 99.64
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 99.64
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 99.64
2qfj_A 216 FBP-interacting repressor; protein-DNA complex; HE 99.63
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 99.63
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 99.63
3tyt_A 205 Heterogeneous nuclear ribonucleoprotein L; ferredo 99.62
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 99.62
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 99.62
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 99.62
2dnl_A114 Cytoplasmic polyadenylation element binding protei 99.62
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 99.61
3pgw_A 282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 99.61
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 99.61
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 99.61
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 99.6
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 99.6
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 99.6
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 99.59
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 99.59
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 99.58
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 99.58
3smz_A 284 Protein raver-1, ribonucleoprotein PTB-binding 1; 99.57
2dit_A112 HIV TAT specific factor 1 variant; structural geno 99.57
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 99.56
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 99.55
2adc_A 229 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.55
1qm9_A 198 Polypyrimidine tract-binding protein; ribonucleopr 99.52
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 99.49
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 99.49
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 99.48
3sde_A 261 Paraspeckle component 1; RRM, anti parallel right 99.48
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.47
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 99.47
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 99.46
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 99.46
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 99.44
2yh0_A 198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 99.43
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 99.43
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 99.4
3tht_A 345 Alkylated DNA repair protein ALKB homolog 8; struc 99.29
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 99.23
2dnr_A91 Synaptojanin-1; RRM domain, RBD, structural genomi 99.07
1owx_A121 Lupus LA protein, SS-B, LA; RRM, transcription; NM 98.96
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 98.94
1ufw_A95 Synaptojanin 2; RNP domain, structural genomics, r 98.83
2l9w_A117 U4/U6 snRNA-associated-splicing factor PRP24; RRM, 98.43
1wey_A104 Calcipressin 1; structural genomics, RRM domain, r 97.51
1whv_A100 Poly(A)-specific ribonuclease; RNA recognition mot 97.38
1uw4_A91 UPF3X; nonsense mediated mRNA decay protein, RNA-b 97.09
1wwh_A119 Nucleoporin 35, nucleoporin; structural genomics, 97.02
2dhx_A104 Poly (ADP-ribose) polymerase family, member 10 var 96.91
3ctr_A101 Poly(A)-specific ribonuclease PARN; protein-RNA-co 96.88
2kn4_A 158 Immunoglobulin G-binding protein G, splicing FACT 95.61
3p3d_A132 Nucleoporin 53; structural genomics, PSI-2, protei 95.56
2i2y_A150 Fusion protein consists of immunoglobin G- binding 95.44
2l08_A97 Regulator of nonsense transcripts 3A; NESG, nonsen 94.87
3pq1_A 464 Poly(A) RNA polymerase; nucleotidyl transferase, R 94.54
1a6b_B40 Momulv, zinc finger protein NCP10; nucleocapsid pr 91.19
3d45_A507 Poly(A)-specific ribonuclease PARN; CAP analogue, 87.26
1u6p_A56 GAG polyprotein; MLV, A-minor K-turn, stem loop, b 87.17
>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
Probab=99.88  E-value=2.9e-22  Score=151.86  Aligned_cols=83  Identities=24%  Similarity=0.457  Sum_probs=80.1

Q ss_pred             CCccEEEEeecCCCCCHHHHHHHhhccCCeeEEEEeecCCCCceeeEEEEEecCHHHHHHHHHHhcCceeCCeEEEEeec
Q psy13227        163 DDTTAIRISNLSVNTSENDLEDLVKQFGPTSKMYLSRDKTNGLCKGFAYIHFKNKADAAKAIQYLNGYGYDHLILSVDWS  242 (247)
Q Consensus       163 ~~~~tl~V~nLp~~~te~dL~~lF~~fG~I~~i~l~~d~~tg~skGfaFV~F~s~e~A~~Ai~~LnG~~i~g~~L~V~~a  242 (247)
                      .+.++|||+|||+++++++|+++|++||.|.++.+++|+.+|.++|||||+|.+.++|++|++.|||..++|+.|+|+||
T Consensus        17 ~~gt~lfV~nLp~~~te~~L~~~F~~~G~I~~v~i~~d~~tg~~kG~afV~f~~~~~A~~Ai~~lng~~~~gr~l~V~~A   96 (99)
T 4fxv_A           17 FQGTNLIVNYLPQNMTQDELRSLFSSIGEVESAKLIRDKVAGHSLGYGFVNYVTAKDAERAINTLNGLRLQSKTIKVSYA   96 (99)
T ss_dssp             CCCSEEEEESCCTTCCHHHHHHHHHTTSCEEEEEEEECSSSCCEEEEEEEEESSHHHHHHHHHHHTTCEETTEECEEEEC
T ss_pred             CCCCEEEEeCCCCCCCHHHHHHHHHhcCCEEEeEeeecCCCCcccccEEEEECCHHHHHHHHHHhCCCEECCEEEEEEEe
Confidence            56689999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCC
Q psy13227        243 KST  245 (247)
Q Consensus       243 kp~  245 (247)
                      +|.
T Consensus        97 kPS   99 (99)
T 4fxv_A           97 RPS   99 (99)
T ss_dssp             CBC
T ss_pred             eCC
Confidence            984



>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Back     alignment and structure
>2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae} Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A Back     alignment and structure
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Back     alignment and structure
>2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2l9w_A U4/U6 snRNA-associated-splicing factor PRP24; RRM, U6 snRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1wey_A Calcipressin 1; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1whv_A Poly(A)-specific ribonuclease; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, PARN, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2rok_A* Back     alignment and structure
>1uw4_A UPF3X; nonsense mediated mRNA decay protein, RNA-binding protein, N domain, MIF4G domain; 1.95A {Homo sapiens} SCOP: d.58.7.4 Back     alignment and structure
>1wwh_A Nucleoporin 35, nucleoporin; structural genomics, MPPN, riken structural genomics/proteomics initiative, RSGI, protein transport; 2.70A {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ctr_A Poly(A)-specific ribonuclease PARN; protein-RNA-complex, M7G-CAP, M7GTP, RNA recognition motif, RRM, cytoplasm, exonuclease, hydrolase, magnesium; HET: MGP; 2.10A {Homo sapiens} Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>3p3d_A Nucleoporin 53; structural genomics, PSI-2, protein structure initiative, NE structural genomix research consortium, nysgxrc; 2.35A {Pichia guilliermondii} Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>2l08_A Regulator of nonsense transcripts 3A; NESG, nonsense regulator, structural genomics, PSI-2, protei structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3pq1_A Poly(A) RNA polymerase; nucleotidyl transferase, RNP-type RNA binding domain, poly(A polymerase, mitochondria, transferase; 3.10A {Homo sapiens} Back     alignment and structure
>1a6b_B Momulv, zinc finger protein NCP10; nucleocapsid protein, intercalation, nucleic acid, retrovirus, viral protein/DNA complex; HET: DNA; NMR {Synthetic} SCOP: g.40.1.1 Back     alignment and structure
>3d45_A Poly(A)-specific ribonuclease PARN; CAP analogue, exonuclease, hydrolase, magnesium, metal nonsense-mediated mRNA decay, nucleus; HET: 7MG GDP; 3.00A {Mus musculus} Back     alignment and structure
>1u6p_A GAG polyprotein; MLV, A-minor K-turn, stem loop, bulge, G-U mismatch, G-A MIS U mismatch, A-C mismatch, zinc finger, NC, viral protein-RN; HET: AP7; NMR {Moloney murine leukemia virus} SCOP: g.40.1.1 PDB: 1wwd_A 1wwe_A 1wwf_A 1wwg_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 247
d2cq0a190 d.58.7.1 (A:231-320) Eukaryotic translation initia 5e-16
d1h2vz_93 d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding pro 5e-15
d2cpha194 d.58.7.1 (A:454-547) Probable RNA-binding protein 3e-14
d1cvja180 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human 5e-14
d1fxla182 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Hom 3e-13
d2cpfa185 d.58.7.1 (A:362-446) Probable RNA-binding protein 6e-13
d1x5ua193 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Hu 7e-13
d2f9da1114 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p 8e-13
d1b7fa182 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophil 1e-12
d1b7fa285 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophil 2e-12
d1rk8a_88 d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Dr 5e-12
d1no8a_78 d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus muscu 6e-12
d2cqia190 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sa 7e-12
d1x4aa195 d.58.7.1 (A:9-103) Splicing factor, arginine/serin 7e-12
d2cqga190 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TD 3e-11
d2cqba189 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomer 3e-11
d2u2fa_85 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 3e-11
d1fjca_96 d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocrice 5e-11
d1fxla285 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Ho 6e-11
d2disa196 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 { 7e-11
d2cqca183 d.58.7.1 (A:109-191) Arginine/serine-rich splicing 1e-10
d1x4ga196 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo s 1e-10
d2cpza1102 d.58.7.1 (A:383-484) CUG triplet repeat RNA-bindin 2e-10
d1x4ba1103 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucle 2e-10
d1wf2a_98 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 2e-10
d1nu4a_91 d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo 3e-10
d1u1qa_183 d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1 3e-10
d1u1qa_183 d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1 2e-06
d1uawa_77 d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [Tax 4e-10
d2ghpa181 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splici 4e-10
d2cpea1101 d.58.7.1 (A:353-453) RNA-binding protein EWS {Huma 4e-10
d2adba1108 d.58.7.1 (A:177-284) Polypyrimidine tract-binding 5e-10
d1whwa_99 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 5e-10
d2cqha180 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 is 6e-10
d2cpja186 d.58.7.1 (A:65-150) Non-POU domain-containing octa 6e-10
d2cq3a193 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human 7e-10
d1x5ta183 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Hu 8e-10
d1u6fa1139 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypa 9e-10
d2cqpa186 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mous 1e-09
d1x5sa190 d.58.7.1 (A:8-97) Cold-inducible RNA-binding prote 1e-09
d2cqda1103 d.58.7.1 (A:1-103) RNA-binding region containing p 1e-09
d1p1ta_104 d.58.7.1 (A:) Cleavage stimulation factor, 64 kda 3e-09
d1cvja289 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human 3e-09
d1x4ea172 d.58.7.1 (A:8-79) RNA-binding motif, single-strand 7e-09
d1x0fa175 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 1e-08
d2cq4a1101 d.58.7.1 (A:132-232) RNA binding protein 23 {Human 2e-08
d1x4ha198 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse ( 3e-08
d1wg1a_88 d.58.7.1 (A:) Probable RNA-binding protein KIAA157 4e-08
d1hd0a_75 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 5e-08
d1wexa_104 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 6e-08
d1l3ka184 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RN 6e-08
d2cpxa1102 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 1e-07
d1whya_97 d.58.7.1 (A:) Putative RNA-binding protein 15B, Rb 2e-07
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 d.58.7.3 (A:) 2e-07
d1wg5a_104 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 2e-07
d1wi8a_104 d.58.7.1 (A:) Eukaryotic translation initiation fa 3e-07
d1wf0a_88 d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 { 3e-07
d2cq2a1101 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 4e-07
d2msta_75 d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 4e-07
d2dita199 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Huma 4e-07
d2cpda186 d.58.7.1 (A:223-308) APOBEC1 stimulating protein { 7e-07
d1weza_102 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 1e-06
d1x5oa1101 d.58.7.1 (A:8-108) RNA-binding motif, single-stran 2e-06
d2bz2a179 d.58.7.1 (A:35-113) Negative elongation factor E, 2e-06
d1weya_104 d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) 3e-06
d1o0pa_104 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 7e-06
d1x4da189 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [ 8e-06
d2adca288 d.58.7.1 (A:444-531) Polypyrimidine tract-binding 1e-05
d2cpia189 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase C 2e-05
d1whxa_111 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 3e-05
d1u2fa_90 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 3e-05
d1wg4a_98 d.58.7.1 (A:) Splicing factor, arginine/serine-ric 3e-05
d1wela1112 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human 9e-05
d2adca1109 d.58.7.1 (A:335-443) Polypyrimidine tract-binding 2e-04
d1wi6a175 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 0.001
d1wwha181 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus mu 0.002
d2cq1a188 d.58.7.1 (A:51-138) Polypyrimidine tract-binding p 0.003
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: Eukaryotic translation initiation factor 3 subunit 4
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 69.3 bits (169), Expect = 5e-16
 Identities = 48/88 (54%), Positives = 67/88 (76%), Gaps = 1/88 (1%)

Query: 160 RRNDDTTAIRISNLSVNTSENDLEDLVKQFGPTSKMYLSRDKTNGLCKGFAYIHFKNKAD 219
           RR DD   IR++NLS +T E DL++L + FG  S++YL++DKT G  KGFA+I F  + D
Sbjct: 3   RRADDNATIRVTNLSEDTRETDLQELFRPFGSISRIYLAKDKTTGQSKGFAFISFHRRED 62

Query: 220 AAKAIQYLNGYGYDHLILSVDWSK-STN 246
           AA+AI  ++G+GYDHLIL+V+W+K STN
Sbjct: 63  AARAIAGVSGFGYDHLILNVEWAKPSTN 90


>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 85 Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 82 Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 85 Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 88 Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Length = 78 Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 96 Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 81 Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Length = 139 Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Length = 72 Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Length = 97 Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Length = 86 Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 111 Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Length = 112 Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Length = 81 Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query247
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 99.89
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 99.87
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 99.87
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.86
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.86
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 99.86
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 99.85
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 99.85
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.84
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 99.84
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.84
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.83
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.83
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 99.83
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.83
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.83
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 99.83
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.83
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.82
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.82
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 99.82
d2cpea1101 RNA-binding protein EWS {Human (Homo sapiens) [Tax 99.82
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.82
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 99.82
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.82
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 99.82
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 99.82
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.81
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 99.81
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 99.81
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 99.81
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 99.81
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.8
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 99.8
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 99.79
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.78
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 99.78
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.78
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.77
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 99.77
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.77
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 99.76
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 99.76
d1fjca_96 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.76
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 99.76
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.75
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 99.75
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 99.75
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 99.75
d2disa196 Hypothetical protein FLJ20273 {Human (Homo sapiens 99.75
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 99.74
d2cpja186 Non-POU domain-containing octamer-binding protein, 99.74
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 99.74
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 99.73
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 99.73
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 99.73
d2cqpa186 RNA-binding protein 12 {Mouse (Mus musculus) [TaxI 99.73
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 99.73
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 99.72
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.72
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 99.72
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 99.72
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 99.72
d1wg5a_104 Heterogeneous nuclear ribonucleoprotein H' {Human 99.72
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.7
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.7
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 99.7
d1wg1a_88 Probable RNA-binding protein KIAA1579 {Human (Homo 99.69
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.68
d2adba1108 Polypyrimidine tract-binding protein {Human (Homo 99.68
d2cpya1103 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.67
d1wi6a175 Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M 99.67
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.64
d2cq1a188 Polypyrimidine tract-binding protein 2, PTBP2 {Hum 99.64
d1wexa_104 Heterogeneous nuclear ribonucleoprotein L-like {Mo 99.63
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.63
d1wela1112 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.62
d1x4da189 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.6
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 99.59
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 U2 99.55
d1u2fa_90 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.55
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.48
d1owxa_113 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.41
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 99.41
d2cq2a1101 Alkylation repair AlkB homolog 8, ALKBH8 {Human (H 99.39
d1wwha181 Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 99.32
d1o0pa_104 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.21
d1uw4a_91 RNA processing protein UPF3x, RRM domain {Human (H 97.14
d1ufwa_95 Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606] 96.91
d2dgxa173 Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 960 96.78
d1whva_100 Poly(A)-specific ribonuclease PARN {Mouse (Mus mus 96.36
d1a6bb_40 Zinc finger protein ncp10 {Moloney murine leukemia 88.89
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: Eukaryotic translation initiation factor 3 subunit 4
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.89  E-value=4.9e-23  Score=151.90  Aligned_cols=87  Identities=51%  Similarity=0.960  Sum_probs=83.4

Q ss_pred             CCCCccEEEEeecCCCCCHHHHHHHhhccCCeeEEEEeecCCCCceeeEEEEEecCHHHHHHHHHHhcCceeCCeEEEEe
Q psy13227        161 RNDDTTAIRISNLSVNTSENDLEDLVKQFGPTSKMYLSRDKTNGLCKGFAYIHFKNKADAAKAIQYLNGYGYDHLILSVD  240 (247)
Q Consensus       161 ~~~~~~tl~V~nLp~~~te~dL~~lF~~fG~I~~i~l~~d~~tg~skGfaFV~F~s~e~A~~Ai~~LnG~~i~g~~L~V~  240 (247)
                      +.++.++|||+|||.++++++|+++|+.||.|.++.|+.++.+|.++|||||+|.+.++|++|++.|||..++|+.|+|+
T Consensus         4 ~~~~~~~i~V~nLp~~~t~~~l~~~f~~~G~v~~v~i~~d~~t~~~rg~afV~f~~~~~A~~Ai~~l~g~~~~g~~i~v~   83 (90)
T d2cq0a1           4 RADDNATIRVTNLSEDTRETDLQELFRPFGSISRIYLAKDKTTGQSKGFAFISFHRREDAARAIAGVSGFGYDHLILNVE   83 (90)
T ss_dssp             CCSSSEEEEEESCCTTCCHHHHHTTSTTTCCEEEEEEEECSSSCSEEEEEEEEESSHHHHHHHHHHTTTCEETTEECEEE
T ss_pred             CCCCCCEEEEECCCCCCCHHHHHHHHHHhcccccccccccccccccccceeEEECCHHHHHHHHHHhCCCEECCEEEEEE
Confidence            45677899999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ecCCCCC
Q psy13227        241 WSKSTNQ  247 (247)
Q Consensus       241 ~akp~~~  247 (247)
                      ||+|+.|
T Consensus        84 ~akp~~n   90 (90)
T d2cq0a1          84 WAKPSTN   90 (90)
T ss_dssp             ESSCCCC
T ss_pred             eeeCCCC
Confidence            9999875



>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uw4a_ d.58.7.4 (A:) RNA processing protein UPF3x, RRM domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ufwa_ d.58.7.1 (A:) Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dgxa1 d.58.7.1 (A:563-635) Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whva_ d.58.7.1 (A:) Poly(A)-specific ribonuclease PARN {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a6bb_ g.40.1.1 (B:) Zinc finger protein ncp10 {Moloney murine leukemia virus, MoMLV [TaxId: 11801]} Back     information, alignment and structure