Diaphorina citri psyllid: psy13231


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100
MFLVDFHNLQPSEGLQGSTNLNWTSPNDCRRARMEYGFSKGQTKICKGWTEIMPHVTKAAYLAANTCTTLFQDRRWNCSSLFLTPKLTPDLITAHSEAEV
ccEEEEcccccccccccccccccccccHHHHHHHcccccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccc
*FLVDFHNLQP***********W****DCRRARMEYGFSKGQTKICKGWTEIMPHVTKAAYLAANTCTTLFQDRRWNCSSLFLTPKLTPDLI********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFLVDFHNLQPSEGLQGSTNLNWTSPNDCRRARMEYGFSKGQTKICKGWTEIMPHVTKAAYLAANTCTTLFQDRRWNCSSLFLTPKLTPDLITAHSEAEV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0048585 [BP]negative regulation of response to stimulusprobableGO:0008150, GO:0048519, GO:0065007, GO:0048583, GO:0050789
GO:0065008 [BP]regulation of biological qualityprobableGO:0008150, GO:0065007
GO:0010556 [BP]regulation of macromolecule biosynthetic processprobableGO:0019222, GO:0060255, GO:0009889, GO:0065007, GO:0008150, GO:0050789
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:2000026 [BP]regulation of multicellular organismal developmentprobableGO:0050793, GO:0008150, GO:0065007, GO:0050789, GO:0051239
GO:0048523 [BP]negative regulation of cellular processprobableGO:0008150, GO:0048519, GO:0065007, GO:0050789, GO:0050794
GO:0048522 [BP]positive regulation of cellular processprobableGO:0048518, GO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0060070 [BP]canonical Wnt receptor signaling pathwayprobableGO:0044700, GO:0051716, GO:0009987, GO:0008150, GO:0050896, GO:0016055, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007154, GO:0050789, GO:0044699
GO:0051094 [BP]positive regulation of developmental processprobableGO:0050793, GO:0048518, GO:0065007, GO:0050789, GO:0008150
GO:0080090 [BP]regulation of primary metabolic processprobableGO:0008150, GO:0065007, GO:0050789, GO:0019222
GO:0009966 [BP]regulation of signal transductionprobableGO:0048583, GO:0050794, GO:0065007, GO:0023051, GO:0008150, GO:0010646, GO:0050789
GO:0048513 [BP]organ developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0003674 [MF]molecular_functionprobable
GO:0031012 [CC]extracellular matrixprobableGO:0005575
GO:0009986 [CC]cell surfaceprobableGO:0005575, GO:0044464, GO:0005623
GO:0010468 [BP]regulation of gene expressionprobableGO:0060255, GO:0008150, GO:0065007, GO:0050789, GO:0019222
GO:0010604 [BP]positive regulation of macromolecule metabolic processprobableGO:0009893, GO:0019222, GO:0060255, GO:0065007, GO:0048518, GO:0008150, GO:0050789
GO:0005576 [CC]extracellular regionprobableGO:0005575
GO:0009790 [BP]embryo developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0008150, GO:0007275, GO:0044699
GO:0031326 [BP]regulation of cellular biosynthetic processprobableGO:0019222, GO:0031323, GO:0009889, GO:0050794, GO:0065007, GO:0008150, GO:0050789
GO:0002009 [BP]morphogenesis of an epitheliumprobableGO:0032502, GO:0048856, GO:0060429, GO:0009888, GO:0044767, GO:0008150, GO:0048729, GO:0009653, GO:0044699
GO:0032879 [BP]regulation of localizationprobableGO:0008150, GO:0065007, GO:0050789

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4F0A, chain B
Confidence level:very confident
Coverage over the Query: 48-100
View the alignment between query and template
View the model in PyMOL