Diaphorina citri psyllid: psy13237


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80----
MFDRSLADFIEGNNVEVKGNLKVQVHYYEDGNVQLVSSKDIKETVVVTSEEQTAREIVKLIEESETAYQQAISENYMIIRKTCD
ccccEEEEECccccCEEEEEEEEEEEEEECcEEEEEEEEccccEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc
*FDRSLADFIEGNNVEVKGNLKVQVHYYEDGNVQLVSSKDIKETVVVTSEEQTAREIVKLIEESETAYQQAISENYMII*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFDRSLADFIEGNNVEVKGNLKVQVHYYEDGNVQLVSSKDIKETVVVTSEEQTAREIVKLIEESETAYQQAISENYMIIRKTCD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
F-actin-capping protein subunit alpha-1 F-actin-capping proteins bind in a Ca(2+)-independent manner to the fast growing ends of actin filaments (barbed end) thereby blocking the exchange of subunits at these ends. Unlike other capping proteins (such as gelsolin and severin), these proteins do not sever actin filaments.confidentP47753
F-actin-capping protein subunit alpha-1 F-actin-capping proteins bind in a Ca(2+)-independent manner to the fast growing ends of actin filaments (barbed end) thereby blocking the exchange of subunits at these ends. Unlike other capping proteins (such as gelsolin and severin), these proteins do not sever actin filaments.confidentA4FUA8
F-actin-capping protein subunit alpha-2 F-actin-capping proteins bind in a Ca(2+)-independent manner to the fast growing ends of actin filaments (barbed end) thereby blocking the exchange of subunits at these ends. Unlike other capping proteins (such as gelsolin and severin), these proteins do not sever actin filaments. CapZ may mediate the attachment of the barbed ends of actin filaments to the Z-line.confidentP28497

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044707 [BP]single-multicellular organism processprobableGO:0032501, GO:0008150, GO:0044699
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0071203 [CC]WASH complexprobableGO:0043234, GO:0005737, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0030863 [CC]cortical cytoskeletonprobableGO:0005856, GO:0005737, GO:0043228, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0071944, GO:0005938, GO:0044424, GO:0043226, GO:0044448
GO:0030018 [CC]Z discprobableGO:0005737, GO:0005575, GO:0043229, GO:0043232, GO:0044464, GO:0031674, GO:0005623, GO:0005622, GO:0030016, GO:0030017, GO:0044444, GO:0043228, GO:0043292, GO:0044424, GO:0043226, GO:0044422, GO:0044449
GO:0016324 [CC]apical plasma membraneprobableGO:0045177, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0051016 [BP]barbed-end actin filament cappingprobableGO:0033043, GO:1901879, GO:0051129, GO:0051128, GO:0008064, GO:0032970, GO:0043244, GO:0050789, GO:0044699, GO:0043242, GO:0030832, GO:0030833, GO:0030834, GO:0030835, GO:0030837, GO:0071840, GO:0051494, GO:0051493, GO:0016043, GO:0090066, GO:0065007, GO:0032271, GO:0032272, GO:0048519, GO:0051693, GO:0065008, GO:0009987, GO:0031333, GO:1901880, GO:0044763, GO:0032956, GO:0043254, GO:0050794, GO:0010639, GO:0044087, GO:0032535, GO:0008150, GO:0048523
GO:0051015 [MF]actin filament bindingprobableGO:0003779, GO:0003674, GO:0005488, GO:0005515, GO:0008092
GO:0005869 [CC]dynactin complexprobableGO:0005856, GO:0043234, GO:0015630, GO:0032991, GO:0015629, GO:0043232, GO:0044464, GO:0005623, GO:0043226, GO:0044446, GO:0043229, GO:0044430, GO:0005575, GO:0044424, GO:0043228, GO:0005622, GO:0005875, GO:0044422
GO:0071822 [BP]protein complex subunit organizationprobableGO:0043933, GO:0008150, GO:0071840, GO:0016043
GO:0008290 [CC]F-actin capping protein complexprobableGO:0043234, GO:0005856, GO:0032991, GO:0015629, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0005575, GO:0044424, GO:0043228, GO:0043226, GO:0044422

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3AA0, chain A
Confidence level:very confident
Coverage over the Query: 2-83
View the alignment between query and template
View the model in PyMOL