Diaphorina citri psyllid: psy1323

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180------
MSFRLCREISFQFRTRLPHGLLVYHSVKDRPEGLDPYALYVIVEKGQLKVVHVFGKHSTSITVGEGLNRDKWHSVMVRINVHGAKLIARVDNRTDETIIKGLDPNTNYGVTSDLTSVVLIGGLSPEEKLHGVKYIIESFIGCIKDMVLSAGKAASDLLPIKPLIATKHEHVEEGCIDKKSPCNRLQ
cccEEEEEEEEEEEcccccEEEEEEEcccccccccccEEEEEEEccEEEEEEEccccCEEEEEccccccccccEEEEEEEccccEEEEEEcccccEEEECcccccccccccccccccEEEccccccccccccEEcccccEEEEccEEEcccccccccccccccccccccccccccccccccccccc
***RLCREISFQFRTRLPHGLLVYHSVKDRPEGLDPYALYVIVEKGQLKVVHVFGKHSTSITVGEGLNRDKWHSVMVRINVHGAKLIARVDNRTDETIIKGLDPNTNYGVTSDLTSVVLIGGLSPEEKLHGVKYIIESFIGCIKDMVLSAGKAASDLLPIKPLIATKHEHVEEGCID**S*C****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSFRLCREISFQFRTRLPHGLLVYHSVKDRPEGLDPYALYVIVEKGQLKVVHVFGKHSTSITVGEGLNRDKWHSVMVRINVHGAKLIARVDNRTDETIIKGLDPNTNYGVTSDLTSVVLIGGLSPEEKLHGVKYIIESFIGCIKDMVLSAGKAASDLLPIKPLIATKHEHVEEGCIDKKSPCNRLQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0019226 [BP]transmission of nerve impulseprobableGO:0044700, GO:0032501, GO:0035637, GO:0044707, GO:0050877, GO:0009987, GO:0008150, GO:0044763, GO:0023052, GO:0007154, GO:0044699, GO:0003008

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3QCW, chain A
Confidence level:very confident
Coverage over the Query: 2-184
View the alignment between query and template
View the model in PyMOL