Diaphorina citri psyllid: psy13271

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110
FQKPKEDTDYPELAKEALIKALDDAGISINQVQQACCGYVYGDSTCGQRALYQIGMTGIPVFNVNNNCSTGSSALMLAKQFIESGSDCTLALGFEKMEKGSLGAKSKPVK
cccccccccHHHHHHHHHHHHHHHcccccccccEEEEEEEccccccHHHHHHHHcccccccEEECcccccHHHHHHHHHHHHHccccEEEEEEEcccccccccccccccc
******DTDYPELAKEALIKALDDAGISINQVQQACCGYVYGDSTCGQRALYQIGMTGIPVFNVNNNCSTGSSALMLAKQFIESGSDCTLALGFEKME************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
FQKPKEDTDYPELAKEALIKALDDAGISINQVQQACCGYVYGDSTCGQRALYQIGMTGIPVFNVNNNCSTGSSALMLAKQFIESGSDCTLALGFEKMEKGSLGAKSKPVK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Non-specific lipid-transfer protein (Fragment) Mediates in vitro the transfer of all common phospholipids, cholesterol and gangliosides between membranes. May play a role in regulating steroidogenesis.confidentQ07598
Non-specific lipid-transfer protein Mediates in vitro the transfer of all common phospholipids, cholesterol and gangliosides between membranes. May play a role in regulating steroidogenesis.confidentP32020
Non-specific lipid-transfer protein Mediates in vitro the transfer of all common phospholipids, cholesterol and gangliosides between membranes. May play a role in regulating steroidogenesis.confidentP22307

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4DD5, chain A
Confidence level:very confident
Coverage over the Query: 6-103
View the alignment between query and template
View the model in PyMOL