Psyllid ID: psy13271
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 110 | ||||||
| 449670340 | 576 | PREDICTED: non-specific lipid-transfer p | 0.954 | 0.182 | 0.703 | 6e-39 | |
| 282165699 | 538 | Sterol carrier protein X-related thiolas | 0.954 | 0.195 | 0.700 | 1e-38 | |
| 125985805 | 544 | GA25964 [Drosophila pseudoobscura pseudo | 0.954 | 0.193 | 0.740 | 2e-38 | |
| 194760231 | 407 | GF14486 [Drosophila ananassae] gi|190616 | 0.954 | 0.257 | 0.731 | 2e-38 | |
| 195147962 | 544 | GL19449 [Drosophila persimilis] gi|19410 | 0.954 | 0.193 | 0.740 | 2e-38 | |
| 194760233 | 544 | GF15421 [Drosophila ananassae] gi|190616 | 0.954 | 0.193 | 0.731 | 2e-38 | |
| 198428552 | 396 | PREDICTED: similar to sterol carrier pro | 0.927 | 0.257 | 0.723 | 4e-38 | |
| 194879982 | 407 | GG21682 [Drosophila erecta] gi|190657528 | 0.954 | 0.257 | 0.722 | 4e-38 | |
| 195579984 | 407 | GD21807 [Drosophila simulans] gi|1941918 | 0.954 | 0.257 | 0.722 | 4e-38 | |
| 170036555 | 544 | nonspecific lipid-transfer protein [Cule | 0.954 | 0.193 | 0.722 | 4e-38 |
| >gi|449670340|ref|XP_002165358.2| PREDICTED: non-specific lipid-transfer protein-like, partial [Hydra magnipapillata] | Back alignment and taxonomy information |
|---|
Score = 164 bits (415), Expect = 6e-39, Method: Compositional matrix adjust.
Identities = 76/108 (70%), Positives = 94/108 (87%), Gaps = 3/108 (2%)
Query: 1 FQKP--KEDTDYPELAKEALIKALDDAGISINQVQQACCGYVYGDSTCGQRALYQIGMTG 58
F+KP ++D DYP + KEA+ +AL+DAGI+ N++QQA CGYVYGDSTCGQRALYQ G+TG
Sbjct: 1 FEKPGARKDFDYPVMVKEAVTQALNDAGITYNEIQQAVCGYVYGDSTCGQRALYQFGLTG 60
Query: 59 IPVFNVNNNCSTGSSALMLAKQFIESGS-DCTLALGFEKMEKGSLGAK 105
IP+ NVNNNCSTGSSAL++AKQ IE G+ DC LA+GFEKME+GSLG+K
Sbjct: 61 IPILNVNNNCSTGSSALLMAKQLIEGGTADCVLAVGFEKMERGSLGSK 108
|
Source: Hydra magnipapillata Species: Hydra magnipapillata Genus: Hydra Family: Hydridae Order: Hydroida Class: Hydrozoa Phylum: Cnidaria Superkingdom: Eukaryota |
| >gi|282165699|ref|NP_001107796.2| Sterol carrier protein X-related thiolase [Tribolium castaneum] gi|270015166|gb|EFA11614.1| sterol carrier protein x [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|125985805|ref|XP_001356666.1| GA25964 [Drosophila pseudoobscura pseudoobscura] gi|54644991|gb|EAL33731.1| GA25964 [Drosophila pseudoobscura pseudoobscura] | Back alignment and taxonomy information |
|---|
| >gi|194760231|ref|XP_001962345.1| GF14486 [Drosophila ananassae] gi|190616042|gb|EDV31566.1| GF14486 [Drosophila ananassae] | Back alignment and taxonomy information |
|---|
| >gi|195147962|ref|XP_002014943.1| GL19449 [Drosophila persimilis] gi|194106896|gb|EDW28939.1| GL19449 [Drosophila persimilis] | Back alignment and taxonomy information |
|---|
| >gi|194760233|ref|XP_001962346.1| GF15421 [Drosophila ananassae] gi|190616043|gb|EDV31567.1| GF15421 [Drosophila ananassae] | Back alignment and taxonomy information |
|---|
| >gi|198428552|ref|XP_002120864.1| PREDICTED: similar to sterol carrier protein 2 [Ciona intestinalis] | Back alignment and taxonomy information |
|---|
| >gi|194879982|ref|XP_001974341.1| GG21682 [Drosophila erecta] gi|190657528|gb|EDV54741.1| GG21682 [Drosophila erecta] | Back alignment and taxonomy information |
|---|
| >gi|195579984|ref|XP_002079836.1| GD21807 [Drosophila simulans] gi|194191845|gb|EDX05421.1| GD21807 [Drosophila simulans] | Back alignment and taxonomy information |
|---|
| >gi|170036555|ref|XP_001846129.1| nonspecific lipid-transfer protein [Culex quinquefasciatus] gi|167879197|gb|EDS42580.1| nonspecific lipid-transfer protein [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 110 | |||
| PRK08256 | 391 | PRK08256, PRK08256, lipid-transfer protein; Provis | 3e-61 | |
| cd00829 | 375 | cd00829, SCP-x_thiolase, Thiolase domain associate | 1e-30 | |
| cd00826 | 393 | cd00826, nondecarbox_cond_enzymes, nondecarboxylat | 1e-22 | |
| cd00327 | 254 | cd00327, cond_enzymes, Condensing enzymes; Family | 3e-20 | |
| COG0183 | 392 | COG0183, PaaJ, Acetyl-CoA acetyltransferase [Lipid | 1e-13 | |
| PRK06064 | 389 | PRK06064, PRK06064, acetyl-CoA acetyltransferase; | 3e-11 | |
| PRK06157 | 398 | PRK06157, PRK06157, acetyl-CoA acetyltransferase; | 2e-10 | |
| cd00751 | 386 | cd00751, thiolase, Thiolase are ubiquitous enzymes | 4e-08 | |
| PRK12578 | 385 | PRK12578, PRK12578, acetyl-CoA acetyltransferase; | 2e-07 | |
| cd00827 | 324 | cd00827, init_cond_enzymes, "initiating" condensin | 3e-07 | |
| COG0332 | 323 | COG0332, FabH, 3-oxoacyl-[acyl-carrier-protein] | 4e-07 | |
| PRK06365 | 430 | PRK06365, PRK06365, acetyl-CoA acetyltransferase; | 4e-07 | |
| PRK06059 | 399 | PRK06059, PRK06059, lipid-transfer protein; Provis | 8e-06 | |
| pfam00108 | 262 | pfam00108, Thiolase_N, Thiolase, N-terminal domain | 1e-05 | |
| cd00830 | 320 | cd00830, KAS_III, Ketoacyl-acyl carrier protein sy | 1e-05 | |
| TIGR00747 | 318 | TIGR00747, fabH, 3-oxoacyl-(acyl-carrier-protein) | 2e-05 | |
| PRK07516 | 389 | PRK07516, PRK07516, acetyl-CoA acetyltransferase; | 2e-05 | |
| PRK05790 | 393 | PRK05790, PRK05790, putative acyltransferase; Prov | 4e-05 | |
| PLN02644 | 394 | PLN02644, PLN02644, acetyl-CoA C-acetyltransferase | 5e-05 | |
| PRK06289 | 403 | PRK06289, PRK06289, acetyl-CoA acetyltransferase; | 8e-05 | |
| TIGR01930 | 386 | TIGR01930, AcCoA-C-Actrans, acetyl-CoA acetyltrans | 2e-04 | |
| PRK09352 | 319 | PRK09352, PRK09352, 3-oxoacyl-(acyl carrier protei | 3e-04 | |
| CHL00203 | 326 | CHL00203, fabH, 3-oxoacyl-acyl-carrier-protein syn | 0.002 | |
| PRK08313 | 386 | PRK08313, PRK08313, acetyl-CoA acetyltransferase; | 0.003 | |
| PRK06366 | 388 | PRK06366, PRK06366, acetyl-CoA acetyltransferase; | 0.003 |
| >gnl|CDD|181327 PRK08256, PRK08256, lipid-transfer protein; Provisional | Back alignment and domain information |
|---|
Score = 191 bits (487), Expect = 3e-61
Identities = 68/106 (64%), Positives = 83/106 (78%), Gaps = 1/106 (0%)
Query: 1 FQKPKEDTDYPELAKEALIKALDDAGISINQVQQACCGYVYGDSTCGQRALYQIGMTGIP 60
F+KP DYP++A EA AL DAGI + VQQA GYVYGDST GQRALY++GMTGIP
Sbjct: 13 FEKPGASWDYPDMAAEAGRAALADAGIDYDAVQQAYVGYVYGDSTSGQRALYEVGMTGIP 72
Query: 61 VFNVNNNCSTGSSALMLAKQFIESG-SDCTLALGFEKMEKGSLGAK 105
+ NVNNNCSTGS+AL LA+Q + SG +DC LALGFE+M+ G+LG+
Sbjct: 73 IVNVNNNCSTGSTALFLARQAVRSGAADCALALGFEQMQPGALGSV 118
|
Length = 391 |
| >gnl|CDD|238425 cd00829, SCP-x_thiolase, Thiolase domain associated with sterol carrier protein (SCP)-x isoform and related proteins; SCP-2 has multiple roles in intracellular lipid circulation and metabolism | Back alignment and domain information |
|---|
| >gnl|CDD|238422 cd00826, nondecarbox_cond_enzymes, nondecarboxylating condensing enzymes; In general, thiolases catalyze the reversible thiolytic cleavage of 3-ketoacyl-CoA into acyl-CoA and acetyl-CoA, a 2-step reaction involving a covalent intermediate formed with a catalytic cysteine | Back alignment and domain information |
|---|
| >gnl|CDD|238201 cd00327, cond_enzymes, Condensing enzymes; Family of enzymes that catalyze a (decarboxylating or non-decarboxylating) Claisen-like condensation reaction | Back alignment and domain information |
|---|
| >gnl|CDD|223261 COG0183, PaaJ, Acetyl-CoA acetyltransferase [Lipid metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|235688 PRK06064, PRK06064, acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180433 PRK06157, PRK06157, acetyl-CoA acetyltransferase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|238383 cd00751, thiolase, Thiolase are ubiquitous enzymes that catalyze the reversible thiolytic cleavage of 3-ketoacyl-CoA into acyl-CoA and acetyl-CoA, a 2-step reaction involving a covalent intermediate formed with a catalytic cysteine | Back alignment and domain information |
|---|
| >gnl|CDD|183606 PRK12578, PRK12578, acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238423 cd00827, init_cond_enzymes, "initiating" condensing enzymes are a subclass of decarboxylating condensing enzymes, including beta-ketoacyl [ACP] synthase, type III and polyketide synthases, type III, which include chalcone synthase and related enzymes | Back alignment and domain information |
|---|
| >gnl|CDD|223409 COG0332, FabH, 3-oxoacyl-[acyl-carrier-protein] | Back alignment and domain information |
|---|
| >gnl|CDD|235785 PRK06365, PRK06365, acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180373 PRK06059, PRK06059, lipid-transfer protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215722 pfam00108, Thiolase_N, Thiolase, N-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|238426 cd00830, KAS_III, Ketoacyl-acyl carrier protein synthase III (KASIII) initiates the elongation in type II fatty acid synthase systems | Back alignment and domain information |
|---|
| >gnl|CDD|233113 TIGR00747, fabH, 3-oxoacyl-(acyl-carrier-protein) synthase III | Back alignment and domain information |
|---|
| >gnl|CDD|181013 PRK07516, PRK07516, acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180261 PRK05790, PRK05790, putative acyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215347 PLN02644, PLN02644, acetyl-CoA C-acetyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|235771 PRK06289, PRK06289, acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233642 TIGR01930, AcCoA-C-Actrans, acetyl-CoA acetyltransferases | Back alignment and domain information |
|---|
| >gnl|CDD|236475 PRK09352, PRK09352, 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|164577 CHL00203, fabH, 3-oxoacyl-acyl-carrier-protein synthase 3; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181378 PRK08313, PRK08313, acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|102340 PRK06366, PRK06366, acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 110 | |||
| COG0332 | 323 | FabH 3-oxoacyl-[acyl-carrier-protein] | 99.84 | |
| PRK08235 | 393 | acetyl-CoA acetyltransferase; Provisional | 99.81 | |
| PF00108 | 264 | Thiolase_N: Thiolase, N-terminal domain; InterPro: | 99.81 | |
| PRK05656 | 393 | acetyl-CoA acetyltransferase; Provisional | 99.8 | |
| PRK07108 | 392 | acetyl-CoA acetyltransferase; Provisional | 99.8 | |
| PRK09051 | 394 | beta-ketothiolase; Provisional | 99.79 | |
| PRK07850 | 387 | acetyl-CoA acetyltransferase; Provisional | 99.79 | |
| PRK06205 | 404 | acetyl-CoA acetyltransferase; Provisional | 99.79 | |
| PRK12578 | 385 | acetyl-CoA acetyltransferase; Provisional | 99.79 | |
| PRK08242 | 402 | acetyl-CoA acetyltransferase; Validated | 99.79 | |
| cd00751 | 386 | thiolase Thiolase are ubiquitous enzymes that cata | 99.78 | |
| PRK08131 | 401 | acetyl-CoA acetyltransferase; Provisional | 99.78 | |
| PRK09052 | 399 | acetyl-CoA acetyltransferase; Provisional | 99.78 | |
| PRK08963 | 428 | fadI 3-ketoacyl-CoA thiolase; Reviewed | 99.77 | |
| PRK06157 | 398 | acetyl-CoA acetyltransferase; Validated | 99.77 | |
| PRK13359 | 400 | beta-ketoadipyl CoA thiolase; Provisional | 99.77 | |
| PRK06954 | 397 | acetyl-CoA acetyltransferase; Provisional | 99.76 | |
| TIGR02446 | 430 | FadI fatty oxidation complex, beta subunit FadI. T | 99.76 | |
| PRK06504 | 390 | acetyl-CoA acetyltransferase; Provisional | 99.75 | |
| PRK06633 | 392 | acetyl-CoA acetyltransferase; Provisional | 99.75 | |
| cd00829 | 375 | SCP-x_thiolase Thiolase domain associated with ste | 99.75 | |
| TIGR01930 | 386 | AcCoA-C-Actrans acetyl-CoA acetyltransferases. Thi | 99.75 | |
| PRK09050 | 401 | beta-ketoadipyl CoA thiolase; Validated | 99.75 | |
| TIGR02845 | 327 | spore_V_AD stage V sporulation protein AD. Bacillu | 99.75 | |
| PRK08256 | 391 | lipid-transfer protein; Provisional | 99.75 | |
| PLN02287 | 452 | 3-ketoacyl-CoA thiolase | 99.75 | |
| PRK07661 | 391 | acetyl-CoA acetyltransferase; Provisional | 99.74 | |
| PRK05790 | 393 | putative acyltransferase; Provisional | 99.74 | |
| TIGR02430 | 400 | pcaF beta-ketoadipyl CoA thiolase. Members of this | 99.74 | |
| PTZ00455 | 438 | 3-ketoacyl-CoA thiolase; Provisional | 99.74 | |
| PRK08313 | 386 | acetyl-CoA acetyltransferase; Provisional | 99.74 | |
| PRK06366 | 388 | acetyl-CoA acetyltransferase; Provisional | 99.74 | |
| PRK07516 | 389 | acetyl-CoA acetyltransferase; Provisional | 99.74 | |
| PRK08170 | 426 | acetyl-CoA acetyltransferase; Provisional | 99.74 | |
| cd00826 | 393 | nondecarbox_cond_enzymes nondecarboxylating conden | 99.73 | |
| PRK07851 | 406 | acetyl-CoA acetyltransferase; Provisional | 99.73 | |
| PRK06289 | 403 | acetyl-CoA acetyltransferase; Provisional | 99.73 | |
| PRK08304 | 337 | stage V sporulation protein AD; Validated | 99.73 | |
| PRK06064 | 389 | acetyl-CoA acetyltransferase; Provisional | 99.73 | |
| CHL00203 | 326 | fabH 3-oxoacyl-acyl-carrier-protein synthase 3; Pr | 99.73 | |
| PRK06365 | 430 | acetyl-CoA acetyltransferase; Provisional | 99.73 | |
| PRK06065 | 392 | acetyl-CoA acetyltransferase; Provisional | 99.72 | |
| PRK12879 | 325 | 3-oxoacyl-(acyl carrier protein) synthase III; Rev | 99.72 | |
| PRK06059 | 399 | lipid-transfer protein; Provisional | 99.71 | |
| PRK06816 | 378 | 3-oxoacyl-(acyl carrier protein) synthase III; Rev | 99.71 | |
| PLN02326 | 379 | 3-oxoacyl-[acyl-carrier-protein] synthase III | 99.71 | |
| PRK05963 | 326 | 3-oxoacyl-(acyl carrier protein) synthase II; Revi | 99.71 | |
| PRK12880 | 353 | 3-oxoacyl-(acyl carrier protein) synthase III; Rev | 99.71 | |
| PRK09258 | 338 | 3-oxoacyl-(acyl carrier protein) synthase III; Rev | 99.71 | |
| PRK09352 | 319 | 3-oxoacyl-(acyl carrier protein) synthase III; Rev | 99.71 | |
| PLN02644 | 394 | acetyl-CoA C-acetyltransferase | 99.7 | |
| TIGR00748 | 345 | HMG_CoA_syn_Arc hydroxymethylglutaryl-CoA synthase | 99.7 | |
| PRK09268 | 427 | acetyl-CoA acetyltransferase; Provisional | 99.7 | |
| PRK07204 | 329 | 3-oxoacyl-(acyl carrier protein) synthase III; Rev | 99.7 | |
| TIGR00747 | 318 | fabH 3-oxoacyl-(acyl-carrier-protein) synthase III | 99.69 | |
| PRK06025 | 417 | acetyl-CoA acetyltransferase; Provisional | 99.69 | |
| PRK06445 | 394 | acetyl-CoA acetyltransferase; Provisional | 99.69 | |
| TIGR02445 | 385 | fadA fatty oxidation complex, beta subunit FadA. T | 99.68 | |
| cd00830 | 320 | KAS_III Ketoacyl-acyl carrier protein synthase III | 99.68 | |
| PRK08947 | 387 | fadA 3-ketoacyl-CoA thiolase; Reviewed | 99.68 | |
| PRK06158 | 384 | thiolase; Provisional | 99.67 | |
| cd00827 | 324 | init_cond_enzymes "initiating" condensing enzymes | 99.66 | |
| PRK07801 | 382 | acetyl-CoA acetyltransferase; Provisional | 99.65 | |
| PLN03168 | 389 | chalcone synthase; Provisional | 99.65 | |
| PLN02932 | 478 | 3-ketoacyl-CoA synthase | 99.65 | |
| PRK04262 | 347 | hypothetical protein; Provisional | 99.65 | |
| PRK12404 | 334 | stage V sporulation protein AD; Provisional | 99.65 | |
| cd00327 | 254 | cond_enzymes Condensing enzymes; Family of enzymes | 99.64 | |
| PRK06690 | 361 | acetyl-CoA acetyltransferase; Provisional | 99.64 | |
| PRK06840 | 339 | hypothetical protein; Validated | 99.63 | |
| PRK07515 | 372 | 3-oxoacyl-(acyl carrier protein) synthase III; Rev | 99.62 | |
| PRK08142 | 388 | acetyl-CoA acetyltransferase; Provisional | 99.61 | |
| cd00831 | 361 | CHS_like Chalcone and stilbene synthases; plant-sp | 99.61 | |
| PLN02377 | 502 | 3-ketoacyl-CoA synthase | 99.61 | |
| PLN02577 | 459 | hydroxymethylglutaryl-CoA synthase | 99.6 | |
| PLN03171 | 399 | chalcone synthase-like protein; Provisional | 99.6 | |
| PLN03169 | 391 | chalcone synthase family protein; Provisional | 99.58 | |
| PLN03170 | 401 | chalcone synthase; Provisional | 99.58 | |
| PLN03172 | 393 | chalcone synthase family protein; Provisional | 99.56 | |
| PLN03173 | 391 | chalcone synthase; Provisional | 99.56 | |
| PRK07855 | 386 | lipid-transfer protein; Provisional | 99.55 | |
| PLN02192 | 511 | 3-ketoacyl-CoA synthase | 99.55 | |
| cd00825 | 332 | decarbox_cond_enzymes decarboxylating condensing e | 99.55 | |
| KOG1406|consensus | 408 | 99.53 | ||
| TIGR01835 | 379 | HMG-CoA-S_prok 3-hydroxy-3-methylglutaryl CoA synt | 99.53 | |
| PRK06066 | 385 | acetyl-CoA acetyltransferase; Provisional | 99.52 | |
| TIGR01833 | 454 | HMG-CoA-S_euk 3-hydroxy-3-methylglutaryl-CoA-synth | 99.52 | |
| COG0183 | 392 | PaaJ Acetyl-CoA acetyltransferase [Lipid metabolis | 99.51 | |
| PLN02854 | 521 | 3-ketoacyl-CoA synthase | 99.5 | |
| PRK08257 | 498 | acetyl-CoA acetyltransferase; Validated | 99.5 | |
| smart00825 | 424 | PKS_KS Beta-ketoacyl synthase. The structure of be | 99.46 | |
| PLN00415 | 466 | 3-ketoacyl-CoA synthase | 99.43 | |
| cd00834 | 406 | KAS_I_II Beta-ketoacyl-acyl carrier protein (ACP) | 99.42 | |
| KOG1390|consensus | 396 | 99.42 | ||
| KOG1391|consensus | 396 | 99.42 | ||
| PRK07314 | 411 | 3-oxoacyl-(acyl carrier protein) synthase II; Revi | 99.4 | |
| cd00828 | 407 | elong_cond_enzymes "elongating" condensing enzymes | 99.39 | |
| PF08392 | 290 | FAE1_CUT1_RppA: FAE1/Type III polyketide synthase- | 99.39 | |
| PTZ00050 | 421 | 3-oxoacyl-acyl carrier protein synthase; Provision | 99.39 | |
| TIGR03150 | 407 | fabF beta-ketoacyl-acyl-carrier-protein synthase I | 99.39 | |
| cd00833 | 421 | PKS polyketide synthases (PKSs) polymerize simple | 99.36 | |
| PRK06333 | 424 | 3-oxoacyl-(acyl carrier protein) synthase II; Revi | 99.36 | |
| PF00195 | 226 | Chal_sti_synt_N: Chalcone and stilbene synthases, | 99.34 | |
| PRK07937 | 352 | lipid-transfer protein; Provisional | 99.33 | |
| PRK08439 | 406 | 3-oxoacyl-(acyl carrier protein) synthase II; Revi | 99.33 | |
| PF00109 | 254 | ketoacyl-synt: Beta-ketoacyl synthase, N-terminal | 99.32 | |
| PRK08722 | 414 | 3-oxoacyl-(acyl carrier protein) synthase II; Revi | 99.31 | |
| PLN02836 | 437 | 3-oxoacyl-[acyl-carrier-protein] synthase | 99.3 | |
| PRK07967 | 406 | 3-oxoacyl-(acyl carrier protein) synthase I; Revie | 99.28 | |
| PRK06147 | 348 | 3-oxoacyl-(acyl carrier protein) synthase; Validat | 99.26 | |
| PRK06519 | 398 | 3-oxoacyl-(acyl carrier protein) synthase II; Revi | 99.25 | |
| COG3425 | 377 | PksG 3-hydroxy-3-methylglutaryl CoA synthase [Lipi | 99.24 | |
| PRK14691 | 342 | 3-oxoacyl-(acyl carrier protein) synthase II; Prov | 99.2 | |
| PLN02787 | 540 | 3-oxoacyl-[acyl-carrier-protein] synthase II | 99.19 | |
| PRK09116 | 405 | 3-oxoacyl-(acyl carrier protein) synthase II; Revi | 99.19 | |
| PRK07103 | 410 | polyketide beta-ketoacyl:acyl carrier protein synt | 99.16 | |
| PF01154 | 174 | HMG_CoA_synt_N: Hydroxymethylglutaryl-coenzyme A s | 99.14 | |
| cd00832 | 399 | CLF Chain-length factor (CLF) is a factor required | 99.12 | |
| PRK06501 | 425 | 3-oxoacyl-(acyl carrier protein) synthase II; Revi | 99.09 | |
| COG3321 | 1061 | Polyketide synthase modules and related proteins [ | 99.09 | |
| PRK07910 | 418 | 3-oxoacyl-(acyl carrier protein) synthase II; Revi | 99.08 | |
| PRK05952 | 381 | 3-oxoacyl-(acyl carrier protein) synthase II; Revi | 99.04 | |
| COG3424 | 356 | BcsA Predicted naringenin-chalcone synthase [Secon | 99.04 | |
| COG0304 | 412 | FabB 3-oxoacyl-(acyl-carrier-protein) synthase [Li | 99.01 | |
| KOG1389|consensus | 435 | 99.01 | ||
| KOG1392|consensus | 465 | 98.98 | ||
| TIGR02813 | 2582 | omega_3_PfaA polyketide-type polyunsaturated fatty | 98.97 | |
| KOG1394|consensus | 440 | 98.96 | ||
| PF07451 | 329 | SpoVAD: Stage V sporulation protein AD (SpoVAD); I | 98.91 | |
| PRK09185 | 392 | 3-oxoacyl-(acyl carrier protein) synthase I; Revie | 98.7 | |
| PF08545 | 80 | ACP_syn_III: 3-Oxoacyl-[acyl-carrier-protein (ACP) | 98.64 | |
| KOG1202|consensus | 2376 | 98.53 | ||
| PF13723 | 218 | Ketoacyl-synt_2: Beta-ketoacyl synthase, N-termina | 97.26 | |
| KOG1393|consensus | 462 | 97.01 | ||
| PF08541 | 90 | ACP_syn_III_C: 3-Oxoacyl-[acyl-carrier-protein (AC | 95.99 | |
| PRK06147 | 348 | 3-oxoacyl-(acyl carrier protein) synthase; Validat | 95.6 | |
| TIGR00748 | 345 | HMG_CoA_syn_Arc hydroxymethylglutaryl-CoA synthase | 95.27 | |
| PF02801 | 119 | Ketoacyl-synt_C: Beta-ketoacyl synthase, C-termina | 95.26 | |
| PRK06816 | 378 | 3-oxoacyl-(acyl carrier protein) synthase III; Rev | 94.64 | |
| PRK08257 | 498 | acetyl-CoA acetyltransferase; Validated | 94.11 | |
| cd00832 | 399 | CLF Chain-length factor (CLF) is a factor required | 93.99 | |
| PRK09258 | 338 | 3-oxoacyl-(acyl carrier protein) synthase III; Rev | 93.98 | |
| PRK07515 | 372 | 3-oxoacyl-(acyl carrier protein) synthase III; Rev | 93.88 | |
| PRK05963 | 326 | 3-oxoacyl-(acyl carrier protein) synthase II; Revi | 93.59 | |
| PRK04262 | 347 | hypothetical protein; Provisional | 93.28 | |
| cd00834 | 406 | KAS_I_II Beta-ketoacyl-acyl carrier protein (ACP) | 93.27 | |
| PRK05952 | 381 | 3-oxoacyl-(acyl carrier protein) synthase II; Revi | 93.25 | |
| PRK07204 | 329 | 3-oxoacyl-(acyl carrier protein) synthase III; Rev | 93.03 | |
| CHL00203 | 326 | fabH 3-oxoacyl-acyl-carrier-protein synthase 3; Pr | 92.87 | |
| PRK06025 | 417 | acetyl-CoA acetyltransferase; Provisional | 92.86 | |
| PRK06840 | 339 | hypothetical protein; Validated | 92.62 | |
| PRK07910 | 418 | 3-oxoacyl-(acyl carrier protein) synthase II; Revi | 92.61 | |
| TIGR03150 | 407 | fabF beta-ketoacyl-acyl-carrier-protein synthase I | 92.58 | |
| PRK06519 | 398 | 3-oxoacyl-(acyl carrier protein) synthase II; Revi | 92.28 | |
| PLN02326 | 379 | 3-oxoacyl-[acyl-carrier-protein] synthase III | 92.16 | |
| cd00828 | 407 | elong_cond_enzymes "elongating" condensing enzymes | 92.09 | |
| PRK09185 | 392 | 3-oxoacyl-(acyl carrier protein) synthase I; Revie | 91.96 | |
| PLN02787 | 540 | 3-oxoacyl-[acyl-carrier-protein] synthase II | 91.92 | |
| PRK07314 | 411 | 3-oxoacyl-(acyl carrier protein) synthase II; Revi | 91.86 | |
| PRK08722 | 414 | 3-oxoacyl-(acyl carrier protein) synthase II; Revi | 91.85 | |
| PRK12879 | 325 | 3-oxoacyl-(acyl carrier protein) synthase III; Rev | 91.48 | |
| COG0304 | 412 | FabB 3-oxoacyl-(acyl-carrier-protein) synthase [Li | 91.44 | |
| TIGR00747 | 318 | fabH 3-oxoacyl-(acyl-carrier-protein) synthase III | 91.21 | |
| cd00830 | 320 | KAS_III Ketoacyl-acyl carrier protein synthase III | 91.08 | |
| PRK05790 | 393 | putative acyltransferase; Provisional | 91.07 | |
| PTZ00050 | 421 | 3-oxoacyl-acyl carrier protein synthase; Provision | 90.91 | |
| PRK09050 | 401 | beta-ketoadipyl CoA thiolase; Validated | 90.87 | |
| TIGR01930 | 386 | AcCoA-C-Actrans acetyl-CoA acetyltransferases. Thi | 90.86 | |
| COG1214 | 220 | Inactive homolog of metal-dependent proteases, put | 90.82 | |
| PRK07103 | 410 | polyketide beta-ketoacyl:acyl carrier protein synt | 90.62 | |
| PLN02287 | 452 | 3-ketoacyl-CoA thiolase | 90.61 | |
| PRK09051 | 394 | beta-ketothiolase; Provisional | 90.46 | |
| PRK09052 | 399 | acetyl-CoA acetyltransferase; Provisional | 90.44 | |
| PRK14691 | 342 | 3-oxoacyl-(acyl carrier protein) synthase II; Prov | 90.44 | |
| TIGR01796 | 117 | CM_mono_aroH monofunctional chorismate mutase, gra | 90.32 | |
| PRK13359 | 400 | beta-ketoadipyl CoA thiolase; Provisional | 90.18 | |
| PF02803 | 123 | Thiolase_C: Thiolase, C-terminal domain; InterPro: | 90.14 | |
| PRK06690 | 361 | acetyl-CoA acetyltransferase; Provisional | 90.12 | |
| PLN02836 | 437 | 3-oxoacyl-[acyl-carrier-protein] synthase | 89.92 | |
| PRK07937 | 352 | lipid-transfer protein; Provisional | 89.77 | |
| PRK06333 | 424 | 3-oxoacyl-(acyl carrier protein) synthase II; Revi | 89.56 | |
| TIGR03285 | 445 | methan_mark_14 putative methanogenesis marker prot | 89.4 | |
| PF07736 | 118 | CM_1: Chorismate mutase type I; InterPro: IPR00824 | 89.38 | |
| TIGR02430 | 400 | pcaF beta-ketoadipyl CoA thiolase. Members of this | 89.34 | |
| PRK09116 | 405 | 3-oxoacyl-(acyl carrier protein) synthase II; Revi | 89.23 | |
| PRK06501 | 425 | 3-oxoacyl-(acyl carrier protein) synthase II; Revi | 89.12 | |
| cd00833 | 421 | PKS polyketide synthases (PKSs) polymerize simple | 88.91 | |
| PRK09352 | 319 | 3-oxoacyl-(acyl carrier protein) synthase III; Rev | 88.9 | |
| cd00825 | 332 | decarbox_cond_enzymes decarboxylating condensing e | 88.74 | |
| smart00825 | 424 | PKS_KS Beta-ketoacyl synthase. The structure of be | 88.66 | |
| cd00751 | 386 | thiolase Thiolase are ubiquitous enzymes that cata | 87.76 | |
| COG0332 | 323 | FabH 3-oxoacyl-[acyl-carrier-protein] | 87.64 | |
| PF00814 | 268 | Peptidase_M22: Glycoprotease family; InterPro: IPR | 87.43 | |
| PRK06205 | 404 | acetyl-CoA acetyltransferase; Provisional | 87.26 | |
| PRK07661 | 391 | acetyl-CoA acetyltransferase; Provisional | 87.24 | |
| PRK05656 | 393 | acetyl-CoA acetyltransferase; Provisional | 87.17 | |
| cd00327 | 254 | cond_enzymes Condensing enzymes; Family of enzymes | 87.03 | |
| TIGR03725 | 202 | bact_YeaZ universal bacterial protein YeaZ. This f | 86.99 | |
| PRK08242 | 402 | acetyl-CoA acetyltransferase; Validated | 86.8 | |
| KOG1394|consensus | 440 | 86.67 | ||
| PRK07850 | 387 | acetyl-CoA acetyltransferase; Provisional | 86.56 | |
| PRK06445 | 394 | acetyl-CoA acetyltransferase; Provisional | 86.16 | |
| PRK06366 | 388 | acetyl-CoA acetyltransferase; Provisional | 85.91 | |
| PRK06954 | 397 | acetyl-CoA acetyltransferase; Provisional | 85.72 | |
| PRK12880 | 353 | 3-oxoacyl-(acyl carrier protein) synthase III; Rev | 85.29 | |
| cd02185 | 117 | AroH Chorismate mutase (AroH) is one of at least f | 85.27 | |
| PRK08235 | 393 | acetyl-CoA acetyltransferase; Provisional | 85.18 | |
| PRK07851 | 406 | acetyl-CoA acetyltransferase; Provisional | 84.74 | |
| PF09887 | 448 | DUF2114: Uncharacterized protein conserved in arch | 84.37 | |
| PRK07801 | 382 | acetyl-CoA acetyltransferase; Provisional | 84.23 | |
| PRK06158 | 384 | thiolase; Provisional | 83.32 | |
| PF14574 | 412 | DUF4445: Domain of unknown function (DUF4445); PDB | 83.28 | |
| PLN02644 | 394 | acetyl-CoA C-acetyltransferase | 82.89 | |
| PRK09604 | 332 | UGMP family protein; Validated | 82.39 | |
| TIGR00329 | 305 | gcp_kae1 metallohydrolase, glycoprotease/Kae1 fami | 82.26 | |
| PRK06504 | 390 | acetyl-CoA acetyltransferase; Provisional | 81.98 | |
| PRK06633 | 392 | acetyl-CoA acetyltransferase; Provisional | 81.5 | |
| PRK08256 | 391 | lipid-transfer protein; Provisional | 81.26 | |
| cd00831 | 361 | CHS_like Chalcone and stilbene synthases; plant-sp | 81.2 | |
| PRK08304 | 337 | stage V sporulation protein AD; Validated | 80.59 | |
| COG3425 | 377 | PksG 3-hydroxy-3-methylglutaryl CoA synthase [Lipi | 80.51 | |
| TIGR02845 | 327 | spore_V_AD stage V sporulation protein AD. Bacillu | 80.45 |
| >COG0332 FabH 3-oxoacyl-[acyl-carrier-protein] | Back alignment and domain information |
|---|
Probab=99.84 E-value=2.5e-20 Score=132.27 Aligned_cols=99 Identities=29% Similarity=0.355 Sum_probs=91.0
Q ss_pred CCCCHHHHHHHHHHHHHHHcCCCccccCeEEEEeecCCCcchh---HHHHHcCCCCCCeeeEeccchHHHHHHHHHHHHH
Q psy13271 6 EDTDYPELAKEALIKALDDAGISINQVQQACCGYVYGDSTCGQ---RALYQIGMTGIPVFNVNNNCSTGSSALMLAKQFI 82 (110)
Q Consensus 6 ~~~~~~~l~~~a~~~al~~agl~~~~id~vi~~~~~~~~~~~~---~~a~~lg~~~~~~~~i~~~C~sg~~al~~A~~~i 82 (110)
+++...+|+.+|+++||+++|++|+|||.||++++++++..|. .++..||++++++|+++.+|++++.||..|..+|
T Consensus 48 ~~e~~s~la~~Aa~~AL~~Agi~~~dIDlII~aT~tpd~~~Ps~A~~vq~~LG~~~~~afDl~aaCsgf~yaL~~A~~~i 127 (323)
T COG0332 48 DDETTSDLAVEAARKALEDAGISPDDIDLIIVATSTPDHLFPSTACLVQARLGLGGAPAFDLQAACSGFLYALSVADGLI 127 (323)
T ss_pred CCccHHHHHHHHHHHHHHHcCCCHHHCCEEEEEcCCcccCCChHHHHHHHHhCCCCcceeechhhhHHHHHHHHHHHHHH
Confidence 4789999999999999999999999999999999999987664 4678899988999999999999999999999999
Q ss_pred HcC-CCeEEEEeeccCCCCCCCC
Q psy13271 83 ESG-SDCTLALGFEKMEKGSLGA 104 (110)
Q Consensus 83 ~sG-~~~vlv~g~e~~s~~~~~~ 104 (110)
++| ++++||+++|.+|+..-+.
T Consensus 128 ~sG~~k~vLVVg~e~~S~~ld~~ 150 (323)
T COG0332 128 RSGGYKNVLVVGAETLSRILDWT 150 (323)
T ss_pred HcCCCCEEEEEehhHhhccCCHh
Confidence 999 9999999999998775443
|
|
| >PRK08235 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF00108 Thiolase_N: Thiolase, N-terminal domain; InterPro: IPR020616 Two different types of thiolase [, , ] are found both in eukaryotes and in prokaryotes: acetoacetyl-CoA thiolase (2 | Back alignment and domain information |
|---|
| >PRK05656 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK07108 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK09051 beta-ketothiolase; Provisional | Back alignment and domain information |
|---|
| >PRK07850 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK06205 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK12578 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK08242 acetyl-CoA acetyltransferase; Validated | Back alignment and domain information |
|---|
| >cd00751 thiolase Thiolase are ubiquitous enzymes that catalyze the reversible thiolytic cleavage of 3-ketoacyl-CoA into acyl-CoA and acetyl-CoA, a 2-step reaction involving a covalent intermediate formed with a catalytic cysteine | Back alignment and domain information |
|---|
| >PRK08131 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK09052 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK08963 fadI 3-ketoacyl-CoA thiolase; Reviewed | Back alignment and domain information |
|---|
| >PRK06157 acetyl-CoA acetyltransferase; Validated | Back alignment and domain information |
|---|
| >PRK13359 beta-ketoadipyl CoA thiolase; Provisional | Back alignment and domain information |
|---|
| >PRK06954 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR02446 FadI fatty oxidation complex, beta subunit FadI | Back alignment and domain information |
|---|
| >PRK06504 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK06633 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd00829 SCP-x_thiolase Thiolase domain associated with sterol carrier protein (SCP)-x isoform and related proteins; SCP-2 has multiple roles in intracellular lipid circulation and metabolism | Back alignment and domain information |
|---|
| >TIGR01930 AcCoA-C-Actrans acetyl-CoA acetyltransferases | Back alignment and domain information |
|---|
| >PRK09050 beta-ketoadipyl CoA thiolase; Validated | Back alignment and domain information |
|---|
| >TIGR02845 spore_V_AD stage V sporulation protein AD | Back alignment and domain information |
|---|
| >PRK08256 lipid-transfer protein; Provisional | Back alignment and domain information |
|---|
| >PLN02287 3-ketoacyl-CoA thiolase | Back alignment and domain information |
|---|
| >PRK07661 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK05790 putative acyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR02430 pcaF beta-ketoadipyl CoA thiolase | Back alignment and domain information |
|---|
| >PTZ00455 3-ketoacyl-CoA thiolase; Provisional | Back alignment and domain information |
|---|
| >PRK08313 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK06366 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK07516 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK08170 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd00826 nondecarbox_cond_enzymes nondecarboxylating condensing enzymes; In general, thiolases catalyze the reversible thiolytic cleavage of 3-ketoacyl-CoA into acyl-CoA and acetyl-CoA, a 2-step reaction involving a covalent intermediate formed with a catalytic cysteine | Back alignment and domain information |
|---|
| >PRK07851 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK06289 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK08304 stage V sporulation protein AD; Validated | Back alignment and domain information |
|---|
| >PRK06064 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >CHL00203 fabH 3-oxoacyl-acyl-carrier-protein synthase 3; Provisional | Back alignment and domain information |
|---|
| >PRK06365 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK06065 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK12879 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed | Back alignment and domain information |
|---|
| >PRK06059 lipid-transfer protein; Provisional | Back alignment and domain information |
|---|
| >PRK06816 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed | Back alignment and domain information |
|---|
| >PLN02326 3-oxoacyl-[acyl-carrier-protein] synthase III | Back alignment and domain information |
|---|
| >PRK05963 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed | Back alignment and domain information |
|---|
| >PRK12880 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed | Back alignment and domain information |
|---|
| >PRK09258 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed | Back alignment and domain information |
|---|
| >PRK09352 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed | Back alignment and domain information |
|---|
| >PLN02644 acetyl-CoA C-acetyltransferase | Back alignment and domain information |
|---|
| >TIGR00748 HMG_CoA_syn_Arc hydroxymethylglutaryl-CoA synthase, putative | Back alignment and domain information |
|---|
| >PRK09268 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK07204 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed | Back alignment and domain information |
|---|
| >TIGR00747 fabH 3-oxoacyl-(acyl-carrier-protein) synthase III | Back alignment and domain information |
|---|
| >PRK06025 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK06445 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR02445 fadA fatty oxidation complex, beta subunit FadA | Back alignment and domain information |
|---|
| >cd00830 KAS_III Ketoacyl-acyl carrier protein synthase III (KASIII) initiates the elongation in type II fatty acid synthase systems | Back alignment and domain information |
|---|
| >PRK08947 fadA 3-ketoacyl-CoA thiolase; Reviewed | Back alignment and domain information |
|---|
| >PRK06158 thiolase; Provisional | Back alignment and domain information |
|---|
| >cd00827 init_cond_enzymes "initiating" condensing enzymes are a subclass of decarboxylating condensing enzymes, including beta-ketoacyl [ACP] synthase, type III and polyketide synthases, type III, which include chalcone synthase and related enzymes | Back alignment and domain information |
|---|
| >PRK07801 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN03168 chalcone synthase; Provisional | Back alignment and domain information |
|---|
| >PLN02932 3-ketoacyl-CoA synthase | Back alignment and domain information |
|---|
| >PRK04262 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK12404 stage V sporulation protein AD; Provisional | Back alignment and domain information |
|---|
| >cd00327 cond_enzymes Condensing enzymes; Family of enzymes that catalyze a (decarboxylating or non-decarboxylating) Claisen-like condensation reaction | Back alignment and domain information |
|---|
| >PRK06690 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK06840 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK07515 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed | Back alignment and domain information |
|---|
| >PRK08142 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd00831 CHS_like Chalcone and stilbene synthases; plant-specific polyketide synthases (PKS) and related enzymes, also called type III PKSs | Back alignment and domain information |
|---|
| >PLN02377 3-ketoacyl-CoA synthase | Back alignment and domain information |
|---|
| >PLN02577 hydroxymethylglutaryl-CoA synthase | Back alignment and domain information |
|---|
| >PLN03171 chalcone synthase-like protein; Provisional | Back alignment and domain information |
|---|
| >PLN03169 chalcone synthase family protein; Provisional | Back alignment and domain information |
|---|
| >PLN03170 chalcone synthase; Provisional | Back alignment and domain information |
|---|
| >PLN03172 chalcone synthase family protein; Provisional | Back alignment and domain information |
|---|
| >PLN03173 chalcone synthase; Provisional | Back alignment and domain information |
|---|
| >PRK07855 lipid-transfer protein; Provisional | Back alignment and domain information |
|---|
| >PLN02192 3-ketoacyl-CoA synthase | Back alignment and domain information |
|---|
| >cd00825 decarbox_cond_enzymes decarboxylating condensing enzymes; Family of enzymes that catalyze the formation of a new carbon-carbon bond by a decarboxylating Claisen-like condensation reaction | Back alignment and domain information |
|---|
| >KOG1406|consensus | Back alignment and domain information |
|---|
| >TIGR01835 HMG-CoA-S_prok 3-hydroxy-3-methylglutaryl CoA synthase, prokaryotic clade | Back alignment and domain information |
|---|
| >PRK06066 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01833 HMG-CoA-S_euk 3-hydroxy-3-methylglutaryl-CoA-synthase, eukaryotic clade | Back alignment and domain information |
|---|
| >COG0183 PaaJ Acetyl-CoA acetyltransferase [Lipid metabolism] | Back alignment and domain information |
|---|
| >PLN02854 3-ketoacyl-CoA synthase | Back alignment and domain information |
|---|
| >PRK08257 acetyl-CoA acetyltransferase; Validated | Back alignment and domain information |
|---|
| >smart00825 PKS_KS Beta-ketoacyl synthase | Back alignment and domain information |
|---|
| >PLN00415 3-ketoacyl-CoA synthase | Back alignment and domain information |
|---|
| >cd00834 KAS_I_II Beta-ketoacyl-acyl carrier protein (ACP) synthase (KAS), type I and II | Back alignment and domain information |
|---|
| >KOG1390|consensus | Back alignment and domain information |
|---|
| >KOG1391|consensus | Back alignment and domain information |
|---|
| >PRK07314 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed | Back alignment and domain information |
|---|
| >cd00828 elong_cond_enzymes "elongating" condensing enzymes are a subclass of decarboxylating condensing enzymes, including beta-ketoacyl [ACP] synthase, type I and II and polyketide synthases | Back alignment and domain information |
|---|
| >PF08392 FAE1_CUT1_RppA: FAE1/Type III polyketide synthase-like protein; InterPro: IPR013601 This domain is found in proteins that are described as 3-ketoacyl-CoA synthases, type III polyketide synthases, fatty acid elongases and fatty acid condensing enzymes, and are found in both prokaryotic and eukaryotic (mainly plant) species | Back alignment and domain information |
|---|
| >PTZ00050 3-oxoacyl-acyl carrier protein synthase; Provisional | Back alignment and domain information |
|---|
| >TIGR03150 fabF beta-ketoacyl-acyl-carrier-protein synthase II | Back alignment and domain information |
|---|
| >cd00833 PKS polyketide synthases (PKSs) polymerize simple fatty acids into a large variety of different products, called polyketides, by successive decarboxylating Claisen condensations | Back alignment and domain information |
|---|
| >PRK06333 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed | Back alignment and domain information |
|---|
| >PF00195 Chal_sti_synt_N: Chalcone and stilbene synthases, N-terminal domain; InterPro: IPR001099 Synonym(s): Chalcone synthase, Flavonone synthase, 6'-deoxychalcone synthase Naringenin-chalcone synthases (2 | Back alignment and domain information |
|---|
| >PRK07937 lipid-transfer protein; Provisional | Back alignment and domain information |
|---|
| >PRK08439 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed | Back alignment and domain information |
|---|
| >PF00109 ketoacyl-synt: Beta-ketoacyl synthase, N-terminal domain; InterPro: IPR014030 Beta-ketoacyl-ACP synthase 2 | Back alignment and domain information |
|---|
| >PRK08722 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed | Back alignment and domain information |
|---|
| >PLN02836 3-oxoacyl-[acyl-carrier-protein] synthase | Back alignment and domain information |
|---|
| >PRK07967 3-oxoacyl-(acyl carrier protein) synthase I; Reviewed | Back alignment and domain information |
|---|
| >PRK06147 3-oxoacyl-(acyl carrier protein) synthase; Validated | Back alignment and domain information |
|---|
| >PRK06519 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed | Back alignment and domain information |
|---|
| >COG3425 PksG 3-hydroxy-3-methylglutaryl CoA synthase [Lipid metabolism] | Back alignment and domain information |
|---|
| >PRK14691 3-oxoacyl-(acyl carrier protein) synthase II; Provisional | Back alignment and domain information |
|---|
| >PLN02787 3-oxoacyl-[acyl-carrier-protein] synthase II | Back alignment and domain information |
|---|
| >PRK09116 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed | Back alignment and domain information |
|---|
| >PRK07103 polyketide beta-ketoacyl:acyl carrier protein synthase; Validated | Back alignment and domain information |
|---|
| >PF01154 HMG_CoA_synt_N: Hydroxymethylglutaryl-coenzyme A synthase N terminal; InterPro: IPR013528 Synonym(s): 3-hydroxy-3-methylglutaryl-coenzyme A synthase, HMG-CoA synthase | Back alignment and domain information |
|---|
| >cd00832 CLF Chain-length factor (CLF) is a factor required for polyketide chain initiation of aromatic antibiotic-producing polyketide synthases (PKSs) of filamentous bacteria | Back alignment and domain information |
|---|
| >PRK06501 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed | Back alignment and domain information |
|---|
| >COG3321 Polyketide synthase modules and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >PRK07910 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed | Back alignment and domain information |
|---|
| >PRK05952 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed | Back alignment and domain information |
|---|
| >COG3424 BcsA Predicted naringenin-chalcone synthase [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >COG0304 FabB 3-oxoacyl-(acyl-carrier-protein) synthase [Lipid metabolism / Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >KOG1389|consensus | Back alignment and domain information |
|---|
| >KOG1392|consensus | Back alignment and domain information |
|---|
| >TIGR02813 omega_3_PfaA polyketide-type polyunsaturated fatty acid synthase PfaA | Back alignment and domain information |
|---|
| >KOG1394|consensus | Back alignment and domain information |
|---|
| >PF07451 SpoVAD: Stage V sporulation protein AD (SpoVAD); InterPro: IPR010894 This family contains the bacterial stage V sporulation protein AD (SpoVAD), which is approximately 340 residues long | Back alignment and domain information |
|---|
| >PRK09185 3-oxoacyl-(acyl carrier protein) synthase I; Reviewed | Back alignment and domain information |
|---|
| >PF08545 ACP_syn_III: 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III; InterPro: IPR013751 Fatty acid synthesis (FAS) is a vital aspect of cellular physiology which can occur by two distinct pathways | Back alignment and domain information |
|---|
| >KOG1202|consensus | Back alignment and domain information |
|---|
| >PF13723 Ketoacyl-synt_2: Beta-ketoacyl synthase, N-terminal domain | Back alignment and domain information |
|---|
| >KOG1393|consensus | Back alignment and domain information |
|---|
| >PF08541 ACP_syn_III_C: 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C terminal ; InterPro: IPR013747 This domain is found on 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III 2 | Back alignment and domain information |
|---|
| >PRK06147 3-oxoacyl-(acyl carrier protein) synthase; Validated | Back alignment and domain information |
|---|
| >TIGR00748 HMG_CoA_syn_Arc hydroxymethylglutaryl-CoA synthase, putative | Back alignment and domain information |
|---|
| >PF02801 Ketoacyl-synt_C: Beta-ketoacyl synthase, C-terminal domain; InterPro: IPR014031 Beta-ketoacyl-ACP synthase 2 | Back alignment and domain information |
|---|
| >PRK06816 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed | Back alignment and domain information |
|---|
| >PRK08257 acetyl-CoA acetyltransferase; Validated | Back alignment and domain information |
|---|
| >cd00832 CLF Chain-length factor (CLF) is a factor required for polyketide chain initiation of aromatic antibiotic-producing polyketide synthases (PKSs) of filamentous bacteria | Back alignment and domain information |
|---|
| >PRK09258 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed | Back alignment and domain information |
|---|
| >PRK07515 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed | Back alignment and domain information |
|---|
| >PRK05963 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed | Back alignment and domain information |
|---|
| >PRK04262 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd00834 KAS_I_II Beta-ketoacyl-acyl carrier protein (ACP) synthase (KAS), type I and II | Back alignment and domain information |
|---|
| >PRK05952 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed | Back alignment and domain information |
|---|
| >PRK07204 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed | Back alignment and domain information |
|---|
| >CHL00203 fabH 3-oxoacyl-acyl-carrier-protein synthase 3; Provisional | Back alignment and domain information |
|---|
| >PRK06025 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK06840 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK07910 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed | Back alignment and domain information |
|---|
| >TIGR03150 fabF beta-ketoacyl-acyl-carrier-protein synthase II | Back alignment and domain information |
|---|
| >PRK06519 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed | Back alignment and domain information |
|---|
| >PLN02326 3-oxoacyl-[acyl-carrier-protein] synthase III | Back alignment and domain information |
|---|
| >cd00828 elong_cond_enzymes "elongating" condensing enzymes are a subclass of decarboxylating condensing enzymes, including beta-ketoacyl [ACP] synthase, type I and II and polyketide synthases | Back alignment and domain information |
|---|
| >PRK09185 3-oxoacyl-(acyl carrier protein) synthase I; Reviewed | Back alignment and domain information |
|---|
| >PLN02787 3-oxoacyl-[acyl-carrier-protein] synthase II | Back alignment and domain information |
|---|
| >PRK07314 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed | Back alignment and domain information |
|---|
| >PRK08722 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed | Back alignment and domain information |
|---|
| >PRK12879 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed | Back alignment and domain information |
|---|
| >COG0304 FabB 3-oxoacyl-(acyl-carrier-protein) synthase [Lipid metabolism / Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >TIGR00747 fabH 3-oxoacyl-(acyl-carrier-protein) synthase III | Back alignment and domain information |
|---|
| >cd00830 KAS_III Ketoacyl-acyl carrier protein synthase III (KASIII) initiates the elongation in type II fatty acid synthase systems | Back alignment and domain information |
|---|
| >PRK05790 putative acyltransferase; Provisional | Back alignment and domain information |
|---|
| >PTZ00050 3-oxoacyl-acyl carrier protein synthase; Provisional | Back alignment and domain information |
|---|
| >PRK09050 beta-ketoadipyl CoA thiolase; Validated | Back alignment and domain information |
|---|
| >TIGR01930 AcCoA-C-Actrans acetyl-CoA acetyltransferases | Back alignment and domain information |
|---|
| >COG1214 Inactive homolog of metal-dependent proteases, putative molecular chaperone [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK07103 polyketide beta-ketoacyl:acyl carrier protein synthase; Validated | Back alignment and domain information |
|---|
| >PLN02287 3-ketoacyl-CoA thiolase | Back alignment and domain information |
|---|
| >PRK09051 beta-ketothiolase; Provisional | Back alignment and domain information |
|---|
| >PRK09052 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14691 3-oxoacyl-(acyl carrier protein) synthase II; Provisional | Back alignment and domain information |
|---|
| >TIGR01796 CM_mono_aroH monofunctional chorismate mutase, gram positive type, clade 1 | Back alignment and domain information |
|---|
| >PRK13359 beta-ketoadipyl CoA thiolase; Provisional | Back alignment and domain information |
|---|
| >PF02803 Thiolase_C: Thiolase, C-terminal domain; InterPro: IPR020617 Two different types of thiolase [, , ] are found both in eukaryotes and in prokaryotes: acetoacetyl-CoA thiolase (2 | Back alignment and domain information |
|---|
| >PRK06690 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02836 3-oxoacyl-[acyl-carrier-protein] synthase | Back alignment and domain information |
|---|
| >PRK07937 lipid-transfer protein; Provisional | Back alignment and domain information |
|---|
| >PRK06333 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed | Back alignment and domain information |
|---|
| >TIGR03285 methan_mark_14 putative methanogenesis marker protein 14 | Back alignment and domain information |
|---|
| >PF07736 CM_1: Chorismate mutase type I; InterPro: IPR008243 Chorismate mutase (CM; 5 | Back alignment and domain information |
|---|
| >TIGR02430 pcaF beta-ketoadipyl CoA thiolase | Back alignment and domain information |
|---|
| >PRK09116 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed | Back alignment and domain information |
|---|
| >PRK06501 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed | Back alignment and domain information |
|---|
| >cd00833 PKS polyketide synthases (PKSs) polymerize simple fatty acids into a large variety of different products, called polyketides, by successive decarboxylating Claisen condensations | Back alignment and domain information |
|---|
| >PRK09352 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed | Back alignment and domain information |
|---|
| >cd00825 decarbox_cond_enzymes decarboxylating condensing enzymes; Family of enzymes that catalyze the formation of a new carbon-carbon bond by a decarboxylating Claisen-like condensation reaction | Back alignment and domain information |
|---|
| >smart00825 PKS_KS Beta-ketoacyl synthase | Back alignment and domain information |
|---|
| >cd00751 thiolase Thiolase are ubiquitous enzymes that catalyze the reversible thiolytic cleavage of 3-ketoacyl-CoA into acyl-CoA and acetyl-CoA, a 2-step reaction involving a covalent intermediate formed with a catalytic cysteine | Back alignment and domain information |
|---|
| >COG0332 FabH 3-oxoacyl-[acyl-carrier-protein] | Back alignment and domain information |
|---|
| >PF00814 Peptidase_M22: Glycoprotease family; InterPro: IPR000905 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >PRK06205 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK07661 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK05656 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd00327 cond_enzymes Condensing enzymes; Family of enzymes that catalyze a (decarboxylating or non-decarboxylating) Claisen-like condensation reaction | Back alignment and domain information |
|---|
| >TIGR03725 bact_YeaZ universal bacterial protein YeaZ | Back alignment and domain information |
|---|
| >PRK08242 acetyl-CoA acetyltransferase; Validated | Back alignment and domain information |
|---|
| >KOG1394|consensus | Back alignment and domain information |
|---|
| >PRK07850 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK06445 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK06366 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK06954 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK12880 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed | Back alignment and domain information |
|---|
| >cd02185 AroH Chorismate mutase (AroH) is one of at least five chorismate-utilizing enzymes present in microorganisms that catalyze the rearrangement of chorismate to prephenic acid, the first committed step in the biosynthesis of aromatic amino acids | Back alignment and domain information |
|---|
| >PRK08235 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK07851 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF09887 DUF2114: Uncharacterized protein conserved in archaea (DUF2114); InterPro: IPR008303 There are currently no experimental data for members of this group or their homologues | Back alignment and domain information |
|---|
| >PRK07801 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK06158 thiolase; Provisional | Back alignment and domain information |
|---|
| >PF14574 DUF4445: Domain of unknown function (DUF4445); PDB: 3ZYY_X | Back alignment and domain information |
|---|
| >PLN02644 acetyl-CoA C-acetyltransferase | Back alignment and domain information |
|---|
| >PRK09604 UGMP family protein; Validated | Back alignment and domain information |
|---|
| >TIGR00329 gcp_kae1 metallohydrolase, glycoprotease/Kae1 family | Back alignment and domain information |
|---|
| >PRK06504 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK06633 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK08256 lipid-transfer protein; Provisional | Back alignment and domain information |
|---|
| >cd00831 CHS_like Chalcone and stilbene synthases; plant-specific polyketide synthases (PKS) and related enzymes, also called type III PKSs | Back alignment and domain information |
|---|
| >PRK08304 stage V sporulation protein AD; Validated | Back alignment and domain information |
|---|
| >COG3425 PksG 3-hydroxy-3-methylglutaryl CoA synthase [Lipid metabolism] | Back alignment and domain information |
|---|
| >TIGR02845 spore_V_AD stage V sporulation protein AD | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 110 | |||
| 3s3l_A | 357 | CERJ; acyltransferase, FABH homologue, KS III homo | 3e-08 | |
| 3lma_A | 347 | Stage V sporulation protein AD (spovad); NESG, str | 1e-07 | |
| 1mzj_A | 339 | Beta-ketoacylsynthase III; beta-ketosynthase, arom | 2e-06 | |
| 3h78_A | 359 | PQS biosynthetic enzyme; PQSD, anthranilic acid, a | 3e-06 | |
| 3ss6_A | 394 | Acetyl-COA acetyltransferase; structural genomics, | 3e-06 | |
| 1hnj_A | 317 | Beta-ketoacyl-acyl carrier protein synthase III; F | 4e-06 | |
| 4dd5_A | 396 | Acetyl-COA acetyltransferase; structural genomics, | 6e-06 | |
| 1u6e_A | 335 | 3-oxoacyl-[acyl-carrier-protein] synthase III; tra | 7e-06 | |
| 4e1l_A | 395 | Acetoacetyl-COA thiolase 2; 3-layer(ABA) sandwich, | 8e-06 | |
| 3il3_A | 323 | 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, | 1e-05 | |
| 2vu1_A | 392 | Acetyl-COA acetyltransferase; acyltransferase, PHB | 2e-05 | |
| 1afw_A | 393 | 3-ketoacetyl-COA thiolase; fatty acid metabolism; | 2e-05 | |
| 2ebd_A | 309 | 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, | 2e-05 | |
| 2iik_A | 418 | 3-ketoacyl-COA thiolase, peroxisomal; fatty acid m | 2e-05 | |
| 1zow_A | 313 | 3-oxoacyl-[acyl-carrier-protein] synthase III; FAB | 3e-05 | |
| 2wu9_A | 442 | 3-ketoacyl-COA thiolase 2, peroxisomal; cysteine o | 5e-05 | |
| 1wl4_A | 397 | Acetyl-coenzyme A acetyltransferase 2; thiolase fo | 1e-04 | |
| 3ov2_A | 393 | Curcumin synthase; type III polyketide synthase, t | 2e-04 | |
| 3s21_A | 345 | 3-oxoacyl-[ACP] synthase III; non-decarboxylative | 2e-04 | |
| 3il6_A | 321 | 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, | 3e-04 | |
| 1u0m_A | 382 | Putative polyketide synthase; type III polyketide | 7e-04 | |
| 3v7i_A | 413 | Putative polyketide synthase; type III polyketide | 8e-04 | |
| 2ib8_A | 395 | Acetyl-COA acetyltransferase; thiolase fold, potas | 8e-04 |
| >3s3l_A CERJ; acyltransferase, FABH homologue, KS III homologue, dimethyl transfer, transferase; 2.00A {Streptomyces tendae} PDB: 3t5y_A* 3t6s_A* 3t8e_A 3t5y_B* Length = 357 | Back alignment and structure |
|---|
Score = 48.8 bits (117), Expect = 3e-08
Identities = 16/89 (17%), Positives = 27/89 (30%), Gaps = 10/89 (11%)
Query: 6 EDTDYPELAKEALIKALDDAGISINQVQQACCGYVYGDSTCG-------QRALYQIGMTG 58
E+ P +A A AL + V ++
Sbjct: 50 EEDAPPRMAARAARAALGRGDVDPADVSLVLHSSLWFQGIDLWPAASYVAHEA---VGRH 106
Query: 59 IPVFNVNNNCSTGSSALMLAKQFIESGSD 87
+P F + C+ G A+ LA ++ SG
Sbjct: 107 VPAFGLAQRCNGGMGAIELAGAYLGSGIG 135
|
| >3lma_A Stage V sporulation protein AD (spovad); NESG, structural genomics, PSI-2, protein structure initiative; 1.99A {Bacillus licheniformis} PDB: 3lm6_A Length = 347 | Back alignment and structure |
|---|
| >1mzj_A Beta-ketoacylsynthase III; beta-ketosynthase, aromatic polyketide, biosynthetic engineering, catalytic triad, transferase; HET: COA; 2.10A {Streptomyces SP} SCOP: c.95.1.2 c.95.1.2 Length = 339 | Back alignment and structure |
|---|
| >3h78_A PQS biosynthetic enzyme; PQSD, anthranilic acid, anthraniloyl-COA, transferase; HET: BE2; 1.70A {Pseudomonas aeruginosa PAO1} PDB: 3h76_A 3h77_A* Length = 359 | Back alignment and structure |
|---|
| >3ss6_A Acetyl-COA acetyltransferase; structural genomics, csgid, center for structural genomics O infectious diseases, alpha beta; HET: CSO; 1.70A {Bacillus anthracis} Length = 394 | Back alignment and structure |
|---|
| >1hnj_A Beta-ketoacyl-acyl carrier protein synthase III; FABH, transferase; HET: MLC; 1.46A {Escherichia coli} SCOP: c.95.1.2 c.95.1.2 PDB: 1hn9_A* 1hnh_A* 1hnd_A* 1hnk_A 1mzs_A* 2eft_A* 2gyo_A* 3il9_A 1ebl_A* Length = 317 | Back alignment and structure |
|---|
| >4dd5_A Acetyl-COA acetyltransferase; structural genomics, center for structural genomics of infec diseases, csgid, thiolase; 1.25A {Clostridium difficile} Length = 396 | Back alignment and structure |
|---|
| >1u6e_A 3-oxoacyl-[acyl-carrier-protein] synthase III; transferase; 1.85A {Mycobacterium tuberculosis} SCOP: c.95.1.2 c.95.1.2 PDB: 1u6s_A* 1m1m_A 1hzp_A* 2qnx_A* 2qnz_A* 2qo1_A* 2qx1_A* 2qo0_A* 2qny_A* 2ahb_A 2aj9_A Length = 335 | Back alignment and structure |
|---|
| >4e1l_A Acetoacetyl-COA thiolase 2; 3-layer(ABA) sandwich, transferase; 2.00A {Clostridium difficile} Length = 395 | Back alignment and structure |
|---|
| >3il3_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, fatty acid biosynthesis, antibiotic, acyltransferase, cytoplasm, lipid synthesis; 2.70A {Haemophilus influenzae} Length = 323 | Back alignment and structure |
|---|
| >2vu1_A Acetyl-COA acetyltransferase; acyltransferase, PHB biosynthesis, thiolase FOL; HET: CSO OPI; 1.51A {Zoogloea ramigera} PDB: 1nl7_A* 1ou6_A* 2vu0_A* 1m4s_A* 2vu2_A* 2wkv_A* 2wku_A* 1m1t_A 1m3k_A 1m1o_A 1m3z_A* 2vtz_A* 2wl5_A* 2wkt_A* 2wl4_A* 1m4t_A* 2wl6_A 1qfl_A* 1dlv_A* 1dlu_A* ... Length = 392 | Back alignment and structure |
|---|
| >1afw_A 3-ketoacetyl-COA thiolase; fatty acid metabolism; 1.80A {Saccharomyces cerevisiae} SCOP: c.95.1.1 c.95.1.1 PDB: 1pxt_A Length = 393 | Back alignment and structure |
|---|
| >2ebd_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, aquifex VF5, lipid metabolism, structural genomics; 2.10A {Aquifex aeolicus} Length = 309 | Back alignment and structure |
|---|
| >2iik_A 3-ketoacyl-COA thiolase, peroxisomal; fatty acid metabolism, structural genomics, structural genom consortium, SGC, transferase; 2.55A {Homo sapiens} Length = 418 | Back alignment and structure |
|---|
| >1zow_A 3-oxoacyl-[acyl-carrier-protein] synthase III; FABH, fatty acid biosynthesis, transferase; 2.00A {Staphylococcus aureus subsp} PDB: 3il7_A Length = 313 | Back alignment and structure |
|---|
| >2wu9_A 3-ketoacyl-COA thiolase 2, peroxisomal; cysteine oxidation, fatty acid metabolism, oxylipin biosynthesis, plant lipid metabolism; 1.50A {Arabidopsis thaliana} PDB: 2c7y_A 2c7z_A 2wua_A Length = 442 | Back alignment and structure |
|---|
| >1wl4_A Acetyl-coenzyme A acetyltransferase 2; thiolase fold; HET: COA; 1.55A {Homo sapiens} PDB: 1wl5_A Length = 397 | Back alignment and structure |
|---|
| >3ov2_A Curcumin synthase; type III polyketide synthase, transferase; 2.32A {Curcuma longa} PDB: 3ov3_A Length = 393 | Back alignment and structure |
|---|
| >3s21_A 3-oxoacyl-[ACP] synthase III; non-decarboxylative claisen condensation reaction, transfera; HET: CER; 1.70A {Xanthomonas campestris PV} PDB: 3s23_A* 3row_A 3s1z_A 3s20_A* 3fk5_A Length = 345 | Back alignment and structure |
|---|
| >3il6_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, fatty acid biosynthesis, antibiotic, acyltransferase, cytoplasm, lipid synthesis; HET: B83; 2.50A {Enterococcus faecalis} PDB: 3il5_A* 3il4_A* Length = 321 | Back alignment and structure |
|---|
| >1u0m_A Putative polyketide synthase; type III polyketide synthase, PKS, bacterial, thiolase fold, beta-alpha-beta-alpha fold, catalytic triad; HET: 15P; 2.22A {Streptomyces coelicolor} SCOP: c.95.1.2 c.95.1.2 Length = 382 | Back alignment and structure |
|---|
| >3v7i_A Putative polyketide synthase; type III polyketide synthase, acyltransferase, transferase,; 2.90A {Streptomyces coelicolor} Length = 413 | Back alignment and structure |
|---|
| >2ib8_A Acetyl-COA acetyltransferase; thiolase fold, potassium ION, chloride, beta-alpha-beta-ALPH alpha-beta-BETA topology; HET: MES; 1.85A {Homo sapiens} PDB: 2ib7_A* 2ib9_A* 2ibu_A* 2ibw_A* 2iby_A* 2f2s_A* Length = 395 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 110 | |||
| 4ewp_A | 350 | 3-oxoacyl-[acyl-carrier-protein] synthase 3; trans | 99.81 | |
| 3lma_A | 347 | Stage V sporulation protein AD (spovad); NESG, str | 99.8 | |
| 3il3_A | 323 | 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, | 99.79 | |
| 4dd5_A | 396 | Acetyl-COA acetyltransferase; structural genomics, | 99.79 | |
| 3goa_A | 387 | 3-ketoacyl-COA thiolase; metabolism, fatty acid, p | 99.79 | |
| 3ss6_A | 394 | Acetyl-COA acetyltransferase; structural genomics, | 99.79 | |
| 4e1l_A | 395 | Acetoacetyl-COA thiolase 2; 3-layer(ABA) sandwich, | 99.78 | |
| 4dfe_A | 333 | 3-oxoacyl-[acyl-carrier-protein] synthase 3; ssgci | 99.78 | |
| 3h78_A | 359 | PQS biosynthetic enzyme; PQSD, anthranilic acid, a | 99.77 | |
| 3gwa_A | 365 | 3-oxoacyl-(acyl-carrier-protein) synthase III; str | 99.77 | |
| 1ulq_A | 401 | Putative acetyl-COA acetyltransferase; structural | 99.77 | |
| 4efi_A | 354 | 3-oxoacyl-(acyl-carrier protein) synthase; structu | 99.77 | |
| 3il6_A | 321 | 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, | 99.77 | |
| 2wu9_A | 442 | 3-ketoacyl-COA thiolase 2, peroxisomal; cysteine o | 99.76 | |
| 1zow_A | 313 | 3-oxoacyl-[acyl-carrier-protein] synthase III; FAB | 99.76 | |
| 2iik_A | 418 | 3-ketoacyl-COA thiolase, peroxisomal; fatty acid m | 99.76 | |
| 3svk_A | 407 | Acetyl-COA acetyltransferase; ssgcid, NIH, niaid, | 99.76 | |
| 3s21_A | 345 | 3-oxoacyl-[ACP] synthase III; non-decarboxylative | 99.75 | |
| 2vu1_A | 392 | Acetyl-COA acetyltransferase; acyltransferase, PHB | 99.75 | |
| 1u6e_A | 335 | 3-oxoacyl-[acyl-carrier-protein] synthase III; tra | 99.75 | |
| 1mzj_A | 339 | Beta-ketoacylsynthase III; beta-ketosynthase, arom | 99.75 | |
| 1wl4_A | 397 | Acetyl-coenzyme A acetyltransferase 2; thiolase fo | 99.75 | |
| 1hnj_A | 317 | Beta-ketoacyl-acyl carrier protein synthase III; F | 99.75 | |
| 1afw_A | 393 | 3-ketoacetyl-COA thiolase; fatty acid metabolism; | 99.75 | |
| 3s3l_A | 357 | CERJ; acyltransferase, FABH homologue, KS III homo | 99.75 | |
| 2ebd_A | 309 | 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, | 99.74 | |
| 3led_A | 392 | 3-oxoacyl-acyl carrier protein synthase III; struc | 99.74 | |
| 1wdk_C | 390 | 3-ketoacyl-COA thiolase; alpha2BETA2 heterotetrame | 99.74 | |
| 2ib8_A | 395 | Acetyl-COA acetyltransferase; thiolase fold, potas | 99.73 | |
| 1ub7_A | 322 | 3-oxoacyl-[acyl-carrier protein] synthase; fatty a | 99.73 | |
| 3oit_A | 387 | OS07G0271500 protein; type III polyketide synthase | 99.7 | |
| 2v4w_A | 460 | Hydroxymethylglutaryl-COA synthase, mitochondrial; | 99.7 | |
| 3ov2_A | 393 | Curcumin synthase; type III polyketide synthase, t | 99.7 | |
| 2h84_A | 374 | Steely1; thiolase-fold, type III polyketide syntha | 99.7 | |
| 3v7i_A | 413 | Putative polyketide synthase; type III polyketide | 99.69 | |
| 1i88_A | 389 | CHS2, chalcone synthase 2; polyketide synthase, tr | 99.68 | |
| 2x3e_A | 331 | 3-oxoacyl-[acyl-carrier-protein] synthase 3; HED, | 99.68 | |
| 3a5r_A | 387 | Benzalacetone synthase; chalcone synthase, type II | 99.68 | |
| 3awk_A | 402 | Chalcone synthase-like polyketide synthase; type I | 99.68 | |
| 2p0u_A | 413 | Stilbenecarboxylate synthase 2; polyketide synthas | 99.68 | |
| 3euo_A | 379 | Type III pentaketide synthase; alpha helix, acyltr | 99.68 | |
| 1u0m_A | 382 | Putative polyketide synthase; type III polyketide | 99.67 | |
| 2d3m_A | 406 | Pentaketide chromone synthase; chalcone synthase, | 99.67 | |
| 3mqd_A | 428 | Beta-ketoacyl synthase; ssgcid, ALS collaborative | 99.66 | |
| 1xes_A | 413 | Dihydropinosylvin synthase; native structure, tran | 99.66 | |
| 1ee0_A | 402 | 2-pyrone synthase; polyketide synthase, thiolase f | 99.66 | |
| 2f82_A | 450 | HMG-COA synthase; HMGS1, transferase; 2.10A {Brass | 99.66 | |
| 3e1h_A | 465 | PKSIIINC, putative uncharacterized protein; resorc | 99.66 | |
| 1ted_A | 393 | PKS18; thiolase fold, substrate binding tunnel, tr | 99.65 | |
| 4egv_A | 520 | Acetyl-COA acetyltransferase; NEW SUB-family, thio | 99.65 | |
| 3v4n_A | 388 | HMG-COA synthase; hydroxymethylglutaryl-COA syntha | 99.63 | |
| 2gqd_A | 437 | 3-oxoacyl-[acyl-carrier-protein] synthase 2; dupli | 99.63 | |
| 3sqz_A | 425 | Putative hydroxymethylglutaryl-COA synthase; thiol | 99.62 | |
| 4ewg_A | 412 | Beta-ketoacyl synthase; ssgcid, structural genomic | 99.62 | |
| 3o04_A | 413 | LMO2201 protein, beta-keto-acyl carrier protein sy | 99.62 | |
| 1e5m_A | 416 | KAS II, beta ketoacyl acyl carrier protein synthas | 99.61 | |
| 3tsy_A | 979 | Fusion protein 4-coumarate--COA ligase 1, resvera | 99.61 | |
| 1ox0_A | 430 | Beta ketoacyl-acyl carrier protein synthase; trans | 99.61 | |
| 2vba_A | 406 | 3-oxoacyl-[acyl-carrier-protein] synthase 1; cytop | 99.6 | |
| 1tqy_A | 424 | Beta-ketoacyl synthase/acyl transferase; alpha-bet | 99.6 | |
| 2ix4_A | 431 | 3-oxoacyl-[acyl-carrier-protein] synthase; beta-ke | 99.6 | |
| 1j3n_A | 408 | 3-oxoacyl-(acyl-carrier protein) synthase II; cond | 99.6 | |
| 3ho9_A | 427 | 3-oxoacyl-[acyl-carrier-protein] synthase 2; FABF, | 99.6 | |
| 2iwz_A | 438 | 3-oxoacyl-[acyl-carrier-protein] synthase; mitocho | 99.59 | |
| 4ddo_A | 451 | 3-oxoacyl-[acyl-carrier-protein] synthase 2; ssgci | 99.58 | |
| 2p8u_A | 478 | Hydroxymethylglutaryl-COA synthase, cytoplasmic; h | 99.56 | |
| 3hhd_A | 965 | Fatty acid synthase; transferase, multienzyme, meg | 99.56 | |
| 1tqy_B | 415 | Actinorhodin polyketide putative beta-ketoacyl SY; | 99.56 | |
| 2qo3_A | 915 | Eryaii erythromycin polyketide synthase modules 3; | 99.55 | |
| 2gp6_A | 434 | 3-oxoacyl-[acyl-carrier-protein] synthase 2; thiol | 99.55 | |
| 3kzu_A | 428 | 3-oxoacyl-(acyl-carrier-protein) synthase II; seat | 99.55 | |
| 2wge_A | 416 | 3-oxoacyl-[acyl-carrier-protein] synthase 1; beta | 99.54 | |
| 1xpm_A | 396 | 3-hydroxy-3-methylglutaryl COA synthase; HMG-COA s | 99.54 | |
| 2hg4_A | 917 | DEBS, 6-deoxyerythronolide B synthase; ketosynthas | 99.54 | |
| 2wya_A | 460 | Hydroxymethylglutaryl-COA synthase, mitochondrial; | 99.51 | |
| 2vz8_A | 2512 | Fatty acid synthase; transferase, phosphopantethei | 99.29 | |
| 3zen_D | 3089 | Fatty acid synthase; transferase, mycolic acid bio | 99.24 | |
| 2pff_A | 1688 | Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl | 99.13 | |
| 2uv8_A | 1887 | Fatty acid synthase subunit alpha (FAS2); fatty ac | 99.13 | |
| 2uv9_A | 1878 | Fatty acid synthase alpha subunits; fungal, dehydr | 99.1 | |
| 3lma_A | 347 | Stage V sporulation protein AD (spovad); NESG, str | 95.98 | |
| 1hnj_A | 317 | Beta-ketoacyl-acyl carrier protein synthase III; F | 95.77 | |
| 1zow_A | 313 | 3-oxoacyl-[acyl-carrier-protein] synthase III; FAB | 95.65 | |
| 1mzj_A | 339 | Beta-ketoacylsynthase III; beta-ketosynthase, arom | 95.59 | |
| 2ebd_A | 309 | 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, | 95.45 | |
| 1ub7_A | 322 | 3-oxoacyl-[acyl-carrier protein] synthase; fatty a | 95.45 | |
| 2x3e_A | 331 | 3-oxoacyl-[acyl-carrier-protein] synthase 3; HED, | 95.39 | |
| 1u6e_A | 335 | 3-oxoacyl-[acyl-carrier-protein] synthase III; tra | 95.33 | |
| 3h78_A | 359 | PQS biosynthetic enzyme; PQSD, anthranilic acid, a | 95.22 | |
| 4dfe_A | 333 | 3-oxoacyl-[acyl-carrier-protein] synthase 3; ssgci | 94.78 | |
| 1ulq_A | 401 | Putative acetyl-COA acetyltransferase; structural | 94.67 | |
| 3s21_A | 345 | 3-oxoacyl-[ACP] synthase III; non-decarboxylative | 94.62 | |
| 4e1l_A | 395 | Acetoacetyl-COA thiolase 2; 3-layer(ABA) sandwich, | 94.29 | |
| 3gwa_A | 365 | 3-oxoacyl-(acyl-carrier-protein) synthase III; str | 94.26 | |
| 4efi_A | 354 | 3-oxoacyl-(acyl-carrier protein) synthase; structu | 94.16 | |
| 1wl4_A | 397 | Acetyl-coenzyme A acetyltransferase 2; thiolase fo | 94.13 | |
| 2vu1_A | 392 | Acetyl-COA acetyltransferase; acyltransferase, PHB | 94.11 | |
| 3ss6_A | 394 | Acetyl-COA acetyltransferase; structural genomics, | 93.88 | |
| 3il3_A | 323 | 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, | 93.68 | |
| 4dd5_A | 396 | Acetyl-COA acetyltransferase; structural genomics, | 93.55 | |
| 1ted_A | 393 | PKS18; thiolase fold, substrate binding tunnel, tr | 93.48 | |
| 4ewp_A | 350 | 3-oxoacyl-[acyl-carrier-protein] synthase 3; trans | 93.3 | |
| 2ib8_A | 395 | Acetyl-COA acetyltransferase; thiolase fold, potas | 93.23 | |
| 1xho_A | 148 | Chorismate mutase; southeast collaboratory for str | 93.07 | |
| 3tsy_A | 979 | Fusion protein 4-coumarate--COA ligase 1, resvera | 92.71 | |
| 3svk_A | 407 | Acetyl-COA acetyltransferase; ssgcid, NIH, niaid, | 92.59 | |
| 3s3l_A | 357 | CERJ; acyltransferase, FABH homologue, KS III homo | 92.57 | |
| 3led_A | 392 | 3-oxoacyl-acyl carrier protein synthase III; struc | 92.46 | |
| 4egv_A | 520 | Acetyl-COA acetyltransferase; NEW SUB-family, thio | 91.89 | |
| 3r6m_A | 213 | YEAZ, resuscitation promoting factor; actin/HSP70 | 91.32 | |
| 1tqy_B | 415 | Actinorhodin polyketide putative beta-ketoacyl SY; | 91.2 | |
| 2iik_A | 418 | 3-ketoacyl-COA thiolase, peroxisomal; fatty acid m | 90.96 | |
| 1dbf_A | 127 | Protein (chorismate mutase); shikimate pathway, is | 90.72 | |
| 3ho9_A | 427 | 3-oxoacyl-[acyl-carrier-protein] synthase 2; FABF, | 90.7 | |
| 1u0m_A | 382 | Putative polyketide synthase; type III polyketide | 90.58 | |
| 2gel_A | 231 | Putative GRAM negative resuscitation promoting FA; | 90.46 | |
| 3kzu_A | 428 | 3-oxoacyl-(acyl-carrier-protein) synthase II; seat | 90.42 | |
| 1ufy_A | 122 | Chorismate mutase; shikimate pathway, mutant, rike | 90.35 | |
| 1wdk_C | 390 | 3-ketoacyl-COA thiolase; alpha2BETA2 heterotetrame | 90.26 | |
| 1j3n_A | 408 | 3-oxoacyl-(acyl-carrier protein) synthase II; cond | 89.89 | |
| 2a6a_A | 218 | Hypothetical protein TM0874; glycoprotein endopept | 89.71 | |
| 4ewg_A | 412 | Beta-ketoacyl synthase; ssgcid, structural genomic | 89.34 | |
| 3o04_A | 413 | LMO2201 protein, beta-keto-acyl carrier protein sy | 89.32 | |
| 3goa_A | 387 | 3-ketoacyl-COA thiolase; metabolism, fatty acid, p | 89.3 | |
| 4ddo_A | 451 | 3-oxoacyl-[acyl-carrier-protein] synthase 2; ssgci | 88.89 | |
| 1tqy_A | 424 | Beta-ketoacyl synthase/acyl transferase; alpha-bet | 88.89 | |
| 1ox0_A | 430 | Beta ketoacyl-acyl carrier protein synthase; trans | 87.96 | |
| 2wge_A | 416 | 3-oxoacyl-[acyl-carrier-protein] synthase 1; beta | 87.18 | |
| 2gp6_A | 434 | 3-oxoacyl-[acyl-carrier-protein] synthase 2; thiol | 86.27 | |
| 2h84_A | 374 | Steely1; thiolase-fold, type III polyketide syntha | 84.8 | |
| 2qo3_A | 915 | Eryaii erythromycin polyketide synthase modules 3; | 84.27 | |
| 2d3m_A | 406 | Pentaketide chromone synthase; chalcone synthase, | 83.92 | |
| 1afw_A | 393 | 3-ketoacetyl-COA thiolase; fatty acid metabolism; | 82.96 | |
| 3eno_A | 334 | Putative O-sialoglycoprotein endopeptidase; hydrol | 82.08 | |
| 2ivn_A | 330 | O-sialoglycoprotein endopeptidase; UP1 keops compl | 81.84 | |
| 3ven_A | 576 | O-carbamoyltransferase TOBZ; antibiotic biosynthes | 81.01 | |
| 2wu9_A | 442 | 3-ketoacyl-COA thiolase 2, peroxisomal; cysteine o | 80.43 | |
| 1e5m_A | 416 | KAS II, beta ketoacyl acyl carrier protein synthas | 80.11 | |
| 3hhd_A | 965 | Fatty acid synthase; transferase, multienzyme, meg | 80.07 | |
| 2gqd_A | 437 | 3-oxoacyl-[acyl-carrier-protein] synthase 2; dupli | 80.02 |
| >4ewp_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; transferase; 2.20A {Micrococcus luteus nctc 2665} | Back alignment and structure |
|---|
Probab=99.81 E-value=4.5e-19 Score=126.03 Aligned_cols=96 Identities=21% Similarity=0.303 Sum_probs=88.0
Q ss_pred CCCCHHHHHHHHHHHHHHHcCCCccccCeEEEEeecCCCcch---hHHHHHcCCCCCCeeeEeccchHHHHHHHHHHHHH
Q psy13271 6 EDTDYPELAKEALIKALDDAGISINQVQQACCGYVYGDSTCG---QRALYQIGMTGIPVFNVNNNCSTGSSALMLAKQFI 82 (110)
Q Consensus 6 ~~~~~~~l~~~a~~~al~~agl~~~~id~vi~~~~~~~~~~~---~~~a~~lg~~~~~~~~i~~~C~sg~~al~~A~~~i 82 (110)
++++..+|+.+|++++|+++|++++|||.||++++++++..| ..+++.||+++.++|+++++|++++.||..|..+|
T Consensus 58 ~~e~~~~la~~Aa~~aL~~ag~~~~dId~li~~t~t~~~~~P~~a~~v~~~LGl~~~~a~di~~~C~g~~~aL~~A~~~i 137 (350)
T 4ewp_A 58 AEETVPVMAVGAAREALERAGLQGSDLDAVIVSTVTFPHATPSAAALVAHEIGATPAPAYDVSAACAGYCYGVAQADALV 137 (350)
T ss_dssp SSCCHHHHHHHHHHHHHHHTTCCGGGCSEEEEECSCCSCSSSCHHHHHHHHTTCTTSCEEEEECGGGHHHHHHHHHHHHH
T ss_pred CCCCHHHHHHHHHHHHHHHcCCCHHHCCEEEEEeccCCCCCCchHHHHHHHhCCCCceEEEeecchhhHHHHHHHhhhhh
Confidence 578999999999999999999999999999999988876544 35778999988899999999999999999999999
Q ss_pred HcC-CCeEEEEeeccCCCCC
Q psy13271 83 ESG-SDCTLALGFEKMEKGS 101 (110)
Q Consensus 83 ~sG-~~~vlv~g~e~~s~~~ 101 (110)
++| .+++||+++|.+|+..
T Consensus 138 ~~g~~~~~Lvv~~E~~s~~~ 157 (350)
T 4ewp_A 138 RSGTARHVLVVGVERLSDVV 157 (350)
T ss_dssp HTTSCSEEEEEEEEEGGGGC
T ss_pred hCCCccceeEeeeeeceecc
Confidence 999 9999999999988654
|
| >3lma_A Stage V sporulation protein AD (spovad); NESG, structural genomics, PSI-2, protein structure initiative; 1.99A {Bacillus licheniformis} PDB: 3lm6_A | Back alignment and structure |
|---|
| >3il3_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, fatty acid biosynthesis, antibiotic, acyltransferase, cytoplasm, lipid synthesis; 2.70A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >4dd5_A Acetyl-COA acetyltransferase; structural genomics, center for structural genomics of infec diseases, csgid, thiolase; 1.25A {Clostridium difficile} | Back alignment and structure |
|---|
| >3goa_A 3-ketoacyl-COA thiolase; metabolism, fatty acid, phospholipid, IDP01071, acyltransferase, cytoplasm, fatty acid metabolism; 1.70A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3ss6_A Acetyl-COA acetyltransferase; structural genomics, csgid, center for structural genomics O infectious diseases, alpha beta; HET: CSO; 1.70A {Bacillus anthracis} | Back alignment and structure |
|---|
| >4e1l_A Acetoacetyl-COA thiolase 2; 3-layer(ABA) sandwich, transferase; 2.00A {Clostridium difficile} | Back alignment and structure |
|---|
| >4dfe_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; ssgcid, seattle structural genomics center for infectious DI transferase; 2.35A {Burkholderia xenovorans} | Back alignment and structure |
|---|
| >3h78_A PQS biosynthetic enzyme; PQSD, anthranilic acid, anthraniloyl-COA, transferase; HET: BE2; 1.70A {Pseudomonas aeruginosa PAO1} PDB: 3h76_A 3h77_A* | Back alignment and structure |
|---|
| >3gwa_A 3-oxoacyl-(acyl-carrier-protein) synthase III; structural genomics, synthetase; 1.60A {Burkholderia pseudomallei} PDB: 3gwe_A | Back alignment and structure |
|---|
| >1ulq_A Putative acetyl-COA acetyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 3.00A {Thermus thermophilus} SCOP: c.95.1.1 c.95.1.1 | Back alignment and structure |
|---|
| >4efi_A 3-oxoacyl-(acyl-carrier protein) synthase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.35A {Burkholderia xenovorans} | Back alignment and structure |
|---|
| >3il6_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, fatty acid biosynthesis, antibiotic, acyltransferase, cytoplasm, lipid synthesis; HET: B83; 2.50A {Enterococcus faecalis} PDB: 3il5_A* 3il4_A* | Back alignment and structure |
|---|
| >2wu9_A 3-ketoacyl-COA thiolase 2, peroxisomal; cysteine oxidation, fatty acid metabolism, oxylipin biosynthesis, plant lipid metabolism; 1.50A {Arabidopsis thaliana} PDB: 2c7y_A 2c7z_A 2wua_A | Back alignment and structure |
|---|
| >1zow_A 3-oxoacyl-[acyl-carrier-protein] synthase III; FABH, fatty acid biosynthesis, transferase; 2.00A {Staphylococcus aureus subsp} PDB: 3il7_A | Back alignment and structure |
|---|
| >2iik_A 3-ketoacyl-COA thiolase, peroxisomal; fatty acid metabolism, structural genomics, structural genom consortium, SGC, transferase; 2.55A {Homo sapiens} | Back alignment and structure |
|---|
| >3svk_A Acetyl-COA acetyltransferase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.20A {Mycobacterium avium} | Back alignment and structure |
|---|
| >3s21_A 3-oxoacyl-[ACP] synthase III; non-decarboxylative claisen condensation reaction, transfera; HET: CER; 1.70A {Xanthomonas campestris PV} PDB: 3s23_A* 3row_A 3s1z_A 3s20_A* 3fk5_A | Back alignment and structure |
|---|
| >2vu1_A Acetyl-COA acetyltransferase; acyltransferase, PHB biosynthesis, thiolase FOL; HET: CSO OPI; 1.51A {Zoogloea ramigera} PDB: 1nl7_A* 1ou6_A* 2vu0_A* 1m4s_A* 2vu2_A* 2wkv_A* 2wku_A* 1m1t_A 1m3k_A 1m1o_A 1m3z_A* 2vtz_A* 2wl5_A* 2wkt_A* 2wl4_A* 1m4t_A* 2wl6_A 1qfl_A* 1dlv_A* 1dlu_A* ... | Back alignment and structure |
|---|
| >1u6e_A 3-oxoacyl-[acyl-carrier-protein] synthase III; transferase; 1.85A {Mycobacterium tuberculosis} SCOP: c.95.1.2 c.95.1.2 PDB: 1u6s_A* 1m1m_A 1hzp_A* 2qnx_A* 2qnz_A* 2qo1_A* 2qx1_A* 2qo0_A* 2qny_A* 2ahb_A 2aj9_A | Back alignment and structure |
|---|
| >1mzj_A Beta-ketoacylsynthase III; beta-ketosynthase, aromatic polyketide, biosynthetic engineering, catalytic triad, transferase; HET: COA; 2.10A {Streptomyces SP} SCOP: c.95.1.2 c.95.1.2 | Back alignment and structure |
|---|
| >1wl4_A Acetyl-coenzyme A acetyltransferase 2; thiolase fold; HET: COA; 1.55A {Homo sapiens} PDB: 1wl5_A | Back alignment and structure |
|---|
| >1hnj_A Beta-ketoacyl-acyl carrier protein synthase III; FABH, transferase; HET: MLC; 1.46A {Escherichia coli} SCOP: c.95.1.2 c.95.1.2 PDB: 1hn9_A* 1hnh_A* 1hnd_A* 1hnk_A 1mzs_A* 2eft_A* 2gyo_A* 3il9_A 1ebl_A* | Back alignment and structure |
|---|
| >1afw_A 3-ketoacetyl-COA thiolase; fatty acid metabolism; 1.80A {Saccharomyces cerevisiae} SCOP: c.95.1.1 c.95.1.1 PDB: 1pxt_A | Back alignment and structure |
|---|
| >3s3l_A CERJ; acyltransferase, FABH homologue, KS III homologue, dimethyl transfer, transferase; 2.00A {Streptomyces tendae} PDB: 3t5y_A* 3t6s_A* 3t8e_A 3t5y_B* | Back alignment and structure |
|---|
| >2ebd_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, aquifex VF5, lipid metabolism, structural genomics; 2.10A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3led_A 3-oxoacyl-acyl carrier protein synthase III; structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.45A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >1wdk_C 3-ketoacyl-COA thiolase; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: c.95.1.1 c.95.1.1 PDB: 1wdl_C* 1wdm_C* 2d3t_C* | Back alignment and structure |
|---|
| >2ib8_A Acetyl-COA acetyltransferase; thiolase fold, potassium ION, chloride, beta-alpha-beta-ALPH alpha-beta-BETA topology; HET: MES; 1.85A {Homo sapiens} PDB: 2ib7_A* 2ib9_A* 2ibu_A* 2ibw_A* 2iby_A* 2f2s_A* | Back alignment and structure |
|---|
| >1ub7_A 3-oxoacyl-[acyl-carrier protein] synthase; fatty acid synthesis, beta-ketoacyl-ACP synthase III, FABH; 2.30A {Thermus thermophilus} SCOP: c.95.1.2 c.95.1.2 | Back alignment and structure |
|---|
| >3oit_A OS07G0271500 protein; type III polyketide synthases, transferase; 2.00A {Oryza sativa} PDB: 3ale_A | Back alignment and structure |
|---|
| >3ov2_A Curcumin synthase; type III polyketide synthase, transferase; 2.32A {Curcuma longa} PDB: 3ov3_A | Back alignment and structure |
|---|
| >2h84_A Steely1; thiolase-fold, type III polyketide synthase, PKS, chalcone-S synthase superfamily, type I PKS; HET: P6G; 2.90A {Dictyostelium discoideum} | Back alignment and structure |
|---|
| >3v7i_A Putative polyketide synthase; type III polyketide synthase, acyltransferase, transferase,; 2.90A {Streptomyces coelicolor} | Back alignment and structure |
|---|
| >2x3e_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; HED, transferase, acyltransferase, lipid synthesis, multifun enzyme; 1.81A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3a5r_A Benzalacetone synthase; chalcone synthase, type III polyketide synthase, transferase, acyltransferase; HET: HC4; 1.60A {Rheum palmatum} PDB: 3a5q_A* 3a5s_A | Back alignment and structure |
|---|
| >1u0m_A Putative polyketide synthase; type III polyketide synthase, PKS, bacterial, thiolase fold, beta-alpha-beta-alpha fold, catalytic triad; HET: 15P; 2.22A {Streptomyces coelicolor} SCOP: c.95.1.2 c.95.1.2 | Back alignment and structure |
|---|
| >3mqd_A Beta-ketoacyl synthase; ssgcid, ALS collaborative crystallography, beta-ketoacyl SYN brucella melitensis, fragments of LIFE; HET: 3MQ; 1.25A {Brucella melitensis biovar abortus} PDB: 3lrf_A* 3u0e_A* 3u0f_A* | Back alignment and structure |
|---|
| >1xes_A Dihydropinosylvin synthase; native structure, transferase; HET: 3IO; 1.70A {Pinus sylvestris} PDB: 1xet_A* 1u0u_A | Back alignment and structure |
|---|
| >2f82_A HMG-COA synthase; HMGS1, transferase; 2.10A {Brassica juncea} PDB: 2f9a_A* 2fa0_A* 2fa3_A* | Back alignment and structure |
|---|
| >3e1h_A PKSIIINC, putative uncharacterized protein; resorcinolic lipid synthase, type III PKS, acyltransferase, transferase; 2.58A {Neurospora crassa} | Back alignment and structure |
|---|
| >1ted_A PKS18; thiolase fold, substrate binding tunnel, transferase; HET: MYR; 2.25A {Mycobacterium tuberculosis} SCOP: c.95.1.2 PDB: 1tee_A | Back alignment and structure |
|---|
| >4egv_A Acetyl-COA acetyltransferase; NEW SUB-family, thiolase fold; 2.71A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >3v4n_A HMG-COA synthase; hydroxymethylglutaryl-COA synthase, nitrosylation, transfera inhibitor complex; HET: BTB; 1.60A {Enterococcus faecalis} PDB: 3v4x_A* 1x9e_A 1ysl_B* 1ysl_A* 2hdb_A* | Back alignment and structure |
|---|
| >2gqd_A 3-oxoacyl-[acyl-carrier-protein] synthase 2; duplicated babababb fold, transferase; 2.30A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >4ewg_A Beta-ketoacyl synthase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, transferase; 2.25A {Burkholderia phymatum} | Back alignment and structure |
|---|
| >3o04_A LMO2201 protein, beta-keto-acyl carrier protein synthase II; csgid, structural genomics; 1.85A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1e5m_A KAS II, beta ketoacyl acyl carrier protein synthase II; condensing enzyme, biosynthetic role, carbon-carbon bond formation; 1.54A {Synechocystis SP} SCOP: c.95.1.1 c.95.1.1 | Back alignment and structure |
|---|
| >3tsy_A Fusion protein 4-coumarate--COA ligase 1, resvera synthase; transferase; 3.10A {Arabidospis thaliana} | Back alignment and structure |
|---|
| >1ox0_A Beta ketoacyl-acyl carrier protein synthase; transferase; 1.30A {Streptococcus pneumoniae} SCOP: c.95.1.1 c.95.1.1 PDB: 1oxh_A 2alm_A 2rjt_A | Back alignment and structure |
|---|
| >2vba_A 3-oxoacyl-[acyl-carrier-protein] synthase 1; cytoplasm, antibiotic, transferase, amino-thiazole, acyltransferase, lipid synthesis; HET: P4T; 1.36A {Escherichia coli} SCOP: c.95.1.1 c.95.1.1 PDB: 1fj4_A* 1g5x_A 2aq7_A* 1fj8_A* 2aqb_A 2bui_A 2buh_A 2vb7_A* 2vb8_A 2vb9_A* 1h4f_A 1dd8_A 2cdh_A 2bz4_A 2byz_A 2bz3_A* 2byy_A* 1f91_A* 2cf2_A 2byw_A ... | Back alignment and structure |
|---|
| >1tqy_A Beta-ketoacyl synthase/acyl transferase; alpha-beta-alpha-beta-alpha, heterodimer, transferase; 2.00A {Streptomyces coelicolor} SCOP: c.95.1.1 c.95.1.1 | Back alignment and structure |
|---|
| >2ix4_A 3-oxoacyl-[acyl-carrier-protein] synthase; beta-ketoacyl-(acyl carrier protein) synthase, lipid metabol condensing enzyme; 1.95A {Arabidopsis thaliana} SCOP: c.95.1.1 c.95.1.1 PDB: 1w0i_A | Back alignment and structure |
|---|
| >1j3n_A 3-oxoacyl-(acyl-carrier protein) synthase II; condensing enzymes, fatty acid elongation, acyl-carrier protein (ACP); HET: CIT; 2.00A {Thermus thermophilus} SCOP: c.95.1.1 c.95.1.1 | Back alignment and structure |
|---|
| >3ho9_A 3-oxoacyl-[acyl-carrier-protein] synthase 2; FABF, platensimycin, platencin A1, KAS2, acyltransferase, fatty acid biosynthesis; HET: N3A; 1.90A {Escherichia coli} PDB: 3hnz_A* 3ho2_A* 3i8p_A* 3g11_A* 2gfx_A* 3g0y_A* 2gfv_A* 2gfw_A 2gfy_A* 1kas_A 1b3n_A | Back alignment and structure |
|---|
| >2iwz_A 3-oxoacyl-[acyl-carrier-protein] synthase; mitochondria, mitochondrion, lipid synthesis, fatty acid SYN fatty acid biosynthesis; 1.65A {Homo sapiens} PDB: 2iwy_A 2c9h_A | Back alignment and structure |
|---|
| >4ddo_A 3-oxoacyl-[acyl-carrier-protein] synthase 2; ssgcid, struct genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia vietnamiensis} PDB: 4f32_A* | Back alignment and structure |
|---|
| >2p8u_A Hydroxymethylglutaryl-COA synthase, cytoplasmic; hydromethylglutaryl COA, mevalonate pathway, structural GENO structural genomics consortium, SGC; HET: COA; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3hhd_A Fatty acid synthase; transferase, multienzyme, megasynthase, fatty acid synthesis, acetylation, cytoplasm, fatty acid biosynthesis, hydrolase; 2.15A {Homo sapiens} PDB: 2jfk_A* 2jfd_A | Back alignment and structure |
|---|
| >1tqy_B Actinorhodin polyketide putative beta-ketoacyl SY; alpha-beta-alpha-beta-alpha, heterodimer, transferase; 2.00A {Streptomyces coelicolor} SCOP: c.95.1.1 c.95.1.1 | Back alignment and structure |
|---|
| >2qo3_A Eryaii erythromycin polyketide synthase modules 3; ketosynthase, acyltransferase, phosphopantetheine, transfera; 2.59A {Saccharopolyspora erythraea} | Back alignment and structure |
|---|
| >2gp6_A 3-oxoacyl-[acyl-carrier-protein] synthase 2; thiolase fold, structural genomics, PSI, protein structure initiative; 2.40A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3kzu_A 3-oxoacyl-(acyl-carrier-protein) synthase II; seattle structural genomics center for infectious disease, ssgcid, acyltransferase; 1.75A {Brucella melitensis} PDB: 3e60_A | Back alignment and structure |
|---|
| >2wge_A 3-oxoacyl-[acyl-carrier-protein] synthase 1; beta ketoacyl synthase I thiolactomycin, cytoplasm, transferase, acyltransferase; HET: TLM; 1.80A {Mycobacterium tuberculosis} PDB: 2wgd_A* 2wgg_A* 2wgf_A* | Back alignment and structure |
|---|
| >1xpm_A 3-hydroxy-3-methylglutaryl COA synthase; HMG-COA synthase, HMGS, coenzyme A, thiolase fold, condensing enzyme; HET: HMG CAA; 1.60A {Staphylococcus aureus subsp} SCOP: c.95.1.2 c.95.1.2 PDB: 1xpl_A* 1xpk_A* 1tvz_A 1txt_A* | Back alignment and structure |
|---|
| >2hg4_A DEBS, 6-deoxyerythronolide B synthase; ketosynthase, acyltransferase, module 5, transferase; 2.73A {Saccharopolyspora erythraea} | Back alignment and structure |
|---|
| >2wya_A Hydroxymethylglutaryl-COA synthase, mitochondrial; steroid biosynthesis, cholesterol biosynthesis, mitochondrion, phosphoprotein; HET: HMG; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* | Back alignment and structure |
|---|
| >3zen_D Fatty acid synthase; transferase, mycolic acid biosynthesis, multifunctional ENZY substrate channeling; HET: FMN; 7.50A {Mycobacterium smegmatis} PDB: 4b3y_A* | Back alignment and structure |
|---|
| >2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-PR; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl RED beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* | Back alignment and structure |
|---|
| >2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* | Back alignment and structure |
|---|
| >3lma_A Stage V sporulation protein AD (spovad); NESG, structural genomics, PSI-2, protein structure initiative; 1.99A {Bacillus licheniformis} PDB: 3lm6_A | Back alignment and structure |
|---|
| >1hnj_A Beta-ketoacyl-acyl carrier protein synthase III; FABH, transferase; HET: MLC; 1.46A {Escherichia coli} SCOP: c.95.1.2 c.95.1.2 PDB: 1hn9_A* 1hnh_A* 1hnd_A* 1hnk_A 1mzs_A* 2eft_A* 2gyo_A* 3il9_A 1ebl_A* | Back alignment and structure |
|---|
| >1zow_A 3-oxoacyl-[acyl-carrier-protein] synthase III; FABH, fatty acid biosynthesis, transferase; 2.00A {Staphylococcus aureus subsp} PDB: 3il7_A | Back alignment and structure |
|---|
| >1mzj_A Beta-ketoacylsynthase III; beta-ketosynthase, aromatic polyketide, biosynthetic engineering, catalytic triad, transferase; HET: COA; 2.10A {Streptomyces SP} SCOP: c.95.1.2 c.95.1.2 | Back alignment and structure |
|---|
| >2ebd_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, aquifex VF5, lipid metabolism, structural genomics; 2.10A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1ub7_A 3-oxoacyl-[acyl-carrier protein] synthase; fatty acid synthesis, beta-ketoacyl-ACP synthase III, FABH; 2.30A {Thermus thermophilus} SCOP: c.95.1.2 c.95.1.2 | Back alignment and structure |
|---|
| >2x3e_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; HED, transferase, acyltransferase, lipid synthesis, multifun enzyme; 1.81A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >1u6e_A 3-oxoacyl-[acyl-carrier-protein] synthase III; transferase; 1.85A {Mycobacterium tuberculosis} SCOP: c.95.1.2 c.95.1.2 PDB: 1u6s_A* 1m1m_A 1hzp_A* 2qnx_A* 2qnz_A* 2qo1_A* 2qx1_A* 2qo0_A* 2qny_A* 2ahb_A 2aj9_A | Back alignment and structure |
|---|
| >3h78_A PQS biosynthetic enzyme; PQSD, anthranilic acid, anthraniloyl-COA, transferase; HET: BE2; 1.70A {Pseudomonas aeruginosa PAO1} PDB: 3h76_A 3h77_A* | Back alignment and structure |
|---|
| >4dfe_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; ssgcid, seattle structural genomics center for infectious DI transferase; 2.35A {Burkholderia xenovorans} | Back alignment and structure |
|---|
| >1ulq_A Putative acetyl-COA acetyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 3.00A {Thermus thermophilus} SCOP: c.95.1.1 c.95.1.1 | Back alignment and structure |
|---|
| >3s21_A 3-oxoacyl-[ACP] synthase III; non-decarboxylative claisen condensation reaction, transfera; HET: CER; 1.70A {Xanthomonas campestris PV} PDB: 3s23_A* 3row_A 3s1z_A 3s20_A* 3fk5_A | Back alignment and structure |
|---|
| >4e1l_A Acetoacetyl-COA thiolase 2; 3-layer(ABA) sandwich, transferase; 2.00A {Clostridium difficile} | Back alignment and structure |
|---|
| >3gwa_A 3-oxoacyl-(acyl-carrier-protein) synthase III; structural genomics, synthetase; 1.60A {Burkholderia pseudomallei} PDB: 3gwe_A | Back alignment and structure |
|---|
| >4efi_A 3-oxoacyl-(acyl-carrier protein) synthase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.35A {Burkholderia xenovorans} | Back alignment and structure |
|---|
| >1wl4_A Acetyl-coenzyme A acetyltransferase 2; thiolase fold; HET: COA; 1.55A {Homo sapiens} PDB: 1wl5_A | Back alignment and structure |
|---|
| >2vu1_A Acetyl-COA acetyltransferase; acyltransferase, PHB biosynthesis, thiolase FOL; HET: CSO OPI; 1.51A {Zoogloea ramigera} PDB: 1nl7_A* 1ou6_A* 2vu0_A* 1m4s_A* 2vu2_A* 2wkv_A* 2wku_A* 1m1t_A 1m3k_A 1m1o_A 1m3z_A* 2vtz_A* 2wl5_A* 2wkt_A* 2wl4_A* 1m4t_A* 2wl6_A 1qfl_A* 1dlv_A* 1dlu_A* ... | Back alignment and structure |
|---|
| >3ss6_A Acetyl-COA acetyltransferase; structural genomics, csgid, center for structural genomics O infectious diseases, alpha beta; HET: CSO; 1.70A {Bacillus anthracis} | Back alignment and structure |
|---|
| >3il3_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, fatty acid biosynthesis, antibiotic, acyltransferase, cytoplasm, lipid synthesis; 2.70A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >4dd5_A Acetyl-COA acetyltransferase; structural genomics, center for structural genomics of infec diseases, csgid, thiolase; 1.25A {Clostridium difficile} | Back alignment and structure |
|---|
| >1ted_A PKS18; thiolase fold, substrate binding tunnel, transferase; HET: MYR; 2.25A {Mycobacterium tuberculosis} SCOP: c.95.1.2 PDB: 1tee_A | Back alignment and structure |
|---|
| >4ewp_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; transferase; 2.20A {Micrococcus luteus nctc 2665} | Back alignment and structure |
|---|
| >2ib8_A Acetyl-COA acetyltransferase; thiolase fold, potassium ION, chloride, beta-alpha-beta-ALPH alpha-beta-BETA topology; HET: MES; 1.85A {Homo sapiens} PDB: 2ib7_A* 2ib9_A* 2ibu_A* 2ibw_A* 2iby_A* 2f2s_A* | Back alignment and structure |
|---|
| >1xho_A Chorismate mutase; southeast collaboratory for structural genomics, secsg, protein structure initiative, PSI, structural genomics; 2.20A {Clostridium thermocellum} SCOP: d.79.1.2 | Back alignment and structure |
|---|
| >3tsy_A Fusion protein 4-coumarate--COA ligase 1, resvera synthase; transferase; 3.10A {Arabidospis thaliana} | Back alignment and structure |
|---|
| >3svk_A Acetyl-COA acetyltransferase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.20A {Mycobacterium avium} | Back alignment and structure |
|---|
| >3s3l_A CERJ; acyltransferase, FABH homologue, KS III homologue, dimethyl transfer, transferase; 2.00A {Streptomyces tendae} PDB: 3t5y_A* 3t6s_A* 3t8e_A 3t5y_B* | Back alignment and structure |
|---|
| >3led_A 3-oxoacyl-acyl carrier protein synthase III; structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.45A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >4egv_A Acetyl-COA acetyltransferase; NEW SUB-family, thiolase fold; 2.71A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >3r6m_A YEAZ, resuscitation promoting factor; actin/HSP70 nucleotide-binding fold, bacterial resuscitation BUT non-culturable state, Y YJEE; 3.10A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >1tqy_B Actinorhodin polyketide putative beta-ketoacyl SY; alpha-beta-alpha-beta-alpha, heterodimer, transferase; 2.00A {Streptomyces coelicolor} SCOP: c.95.1.1 c.95.1.1 | Back alignment and structure |
|---|
| >2iik_A 3-ketoacyl-COA thiolase, peroxisomal; fatty acid metabolism, structural genomics, structural genom consortium, SGC, transferase; 2.55A {Homo sapiens} | Back alignment and structure |
|---|
| >1dbf_A Protein (chorismate mutase); shikimate pathway, isomerase; 1.30A {Bacillus subtilis} SCOP: d.79.1.2 PDB: 1com_A 2chs_A 2cht_A* 1fnj_A 1fnk_A | Back alignment and structure |
|---|
| >3ho9_A 3-oxoacyl-[acyl-carrier-protein] synthase 2; FABF, platensimycin, platencin A1, KAS2, acyltransferase, fatty acid biosynthesis; HET: N3A; 1.90A {Escherichia coli} PDB: 3hnz_A* 3ho2_A* 3i8p_A* 3g11_A* 2gfx_A* 3g0y_A* 2gfv_A* 2gfw_A 2gfy_A* 1kas_A 1b3n_A | Back alignment and structure |
|---|
| >1u0m_A Putative polyketide synthase; type III polyketide synthase, PKS, bacterial, thiolase fold, beta-alpha-beta-alpha fold, catalytic triad; HET: 15P; 2.22A {Streptomyces coelicolor} SCOP: c.95.1.2 c.95.1.2 | Back alignment and structure |
|---|
| >2gel_A Putative GRAM negative resuscitation promoting FA; YEAZ, RPF, actin-like-fold, glycoprotease, chaperone; 2.05A {Salmonella typhimurium} PDB: 2gem_A 1okj_A | Back alignment and structure |
|---|
| >3kzu_A 3-oxoacyl-(acyl-carrier-protein) synthase II; seattle structural genomics center for infectious disease, ssgcid, acyltransferase; 1.75A {Brucella melitensis} PDB: 3e60_A | Back alignment and structure |
|---|
| >1ufy_A Chorismate mutase; shikimate pathway, mutant, riken structur genomics/proteomics initiative, RSGI, structural genomics,; HET: MES; 0.96A {Thermus thermophilus} SCOP: d.79.1.2 PDB: 1ode_A* 1ui9_A* | Back alignment and structure |
|---|
| >1wdk_C 3-ketoacyl-COA thiolase; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: c.95.1.1 c.95.1.1 PDB: 1wdl_C* 1wdm_C* 2d3t_C* | Back alignment and structure |
|---|
| >1j3n_A 3-oxoacyl-(acyl-carrier protein) synthase II; condensing enzymes, fatty acid elongation, acyl-carrier protein (ACP); HET: CIT; 2.00A {Thermus thermophilus} SCOP: c.95.1.1 c.95.1.1 | Back alignment and structure |
|---|
| >2a6a_A Hypothetical protein TM0874; glycoprotein endopeptidase, structural genomics, JOI for structural genomics, JCSG; 2.50A {Thermotoga maritima} SCOP: c.55.1.9 c.55.1.9 | Back alignment and structure |
|---|
| >4ewg_A Beta-ketoacyl synthase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, transferase; 2.25A {Burkholderia phymatum} | Back alignment and structure |
|---|
| >3o04_A LMO2201 protein, beta-keto-acyl carrier protein synthase II; csgid, structural genomics; 1.85A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3goa_A 3-ketoacyl-COA thiolase; metabolism, fatty acid, phospholipid, IDP01071, acyltransferase, cytoplasm, fatty acid metabolism; 1.70A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >4ddo_A 3-oxoacyl-[acyl-carrier-protein] synthase 2; ssgcid, struct genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia vietnamiensis} PDB: 4f32_A* | Back alignment and structure |
|---|
| >1tqy_A Beta-ketoacyl synthase/acyl transferase; alpha-beta-alpha-beta-alpha, heterodimer, transferase; 2.00A {Streptomyces coelicolor} SCOP: c.95.1.1 c.95.1.1 | Back alignment and structure |
|---|
| >1ox0_A Beta ketoacyl-acyl carrier protein synthase; transferase; 1.30A {Streptococcus pneumoniae} SCOP: c.95.1.1 c.95.1.1 PDB: 1oxh_A 2alm_A 2rjt_A | Back alignment and structure |
|---|
| >2wge_A 3-oxoacyl-[acyl-carrier-protein] synthase 1; beta ketoacyl synthase I thiolactomycin, cytoplasm, transferase, acyltransferase; HET: TLM; 1.80A {Mycobacterium tuberculosis} PDB: 2wgd_A* 2wgg_A* 2wgf_A* | Back alignment and structure |
|---|
| >2gp6_A 3-oxoacyl-[acyl-carrier-protein] synthase 2; thiolase fold, structural genomics, PSI, protein structure initiative; 2.40A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2h84_A Steely1; thiolase-fold, type III polyketide synthase, PKS, chalcone-S synthase superfamily, type I PKS; HET: P6G; 2.90A {Dictyostelium discoideum} | Back alignment and structure |
|---|
| >2qo3_A Eryaii erythromycin polyketide synthase modules 3; ketosynthase, acyltransferase, phosphopantetheine, transfera; 2.59A {Saccharopolyspora erythraea} | Back alignment and structure |
|---|
| >2d3m_A Pentaketide chromone synthase; chalcone synthase, polyketide synthase, transferase; HET: COA; 1.60A {Aloe arborescens} PDB: 2d51_A 2d52_A* | Back alignment and structure |
|---|
| >1afw_A 3-ketoacetyl-COA thiolase; fatty acid metabolism; 1.80A {Saccharomyces cerevisiae} SCOP: c.95.1.1 c.95.1.1 PDB: 1pxt_A | Back alignment and structure |
|---|
| >3eno_A Putative O-sialoglycoprotein endopeptidase; hydrolase, metal-binding, metalloprotease, protease, zinc, keops complex, ATPase, metal ION binding; 3.02A {Thermoplasma acidophilum} | Back alignment and structure |
|---|
| >2ivn_A O-sialoglycoprotein endopeptidase; UP1 keops complex, Fe/Zn dependent nucleotide phosphatase, metalloprotease, hypothetical protein, zinc; HET: ANP; 1.65A {Pyrococcus abyssi} PDB: 2ivo_A 2ivp_A* | Back alignment and structure |
|---|
| >3ven_A O-carbamoyltransferase TOBZ; antibiotic biosynthesis, substrate assisted catalysis, subst channeling, adenylation; HET: TLA; 1.57A {Streptoalloteichus tenebrarius} PDB: 3veo_A 3ves_A* 3vet_A* 3vew_A* 3ver_A* 3vf4_A* 3vf2_A* 3vex_A* 3vez_A* | Back alignment and structure |
|---|
| >2wu9_A 3-ketoacyl-COA thiolase 2, peroxisomal; cysteine oxidation, fatty acid metabolism, oxylipin biosynthesis, plant lipid metabolism; 1.50A {Arabidopsis thaliana} PDB: 2c7y_A 2c7z_A 2wua_A | Back alignment and structure |
|---|
| >1e5m_A KAS II, beta ketoacyl acyl carrier protein synthase II; condensing enzyme, biosynthetic role, carbon-carbon bond formation; 1.54A {Synechocystis SP} SCOP: c.95.1.1 c.95.1.1 | Back alignment and structure |
|---|
| >3hhd_A Fatty acid synthase; transferase, multienzyme, megasynthase, fatty acid synthesis, acetylation, cytoplasm, fatty acid biosynthesis, hydrolase; 2.15A {Homo sapiens} PDB: 2jfk_A* 2jfd_A | Back alignment and structure |
|---|
| >2gqd_A 3-oxoacyl-[acyl-carrier-protein] synthase 2; duplicated babababb fold, transferase; 2.30A {Staphylococcus aureus} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 110 | ||||
| d1bi5a1 | 235 | c.95.1.2 (A:1-235) Chalcone synthase {Alfalfa (Med | 8e-08 | |
| d1u0ma1 | 200 | c.95.1.2 (A:2-201) Putative polyketide synthase SC | 8e-06 | |
| d1ulqa1 | 273 | c.95.1.1 (A:3-275) Beta-ketoadipyl CoA thiolase {T | 2e-04 | |
| d1teda_ | 372 | c.95.1.2 (A:) Polyketide synthase PKS18 {Mycobacte | 0.001 |
| >d1bi5a1 c.95.1.2 (A:1-235) Chalcone synthase {Alfalfa (Medicago sativa) [TaxId: 3879]} Length = 235 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Thiolase-like superfamily: Thiolase-like family: Chalcone synthase-like domain: Chalcone synthase species: Alfalfa (Medicago sativa) [TaxId: 3879]
Score = 46.3 bits (109), Expect = 8e-08
Identities = 19/97 (19%), Positives = 31/97 (31%), Gaps = 5/97 (5%)
Query: 6 EDTDYPELAKEALIKALDDAGISINQVQQACCGYVYGD----STCGQRALYQIGMTGIPV 61
+ P L KEA +KA+ + G +++ G + L +
Sbjct: 98 VVVEVPRLGKEAAVKAIKEWGQPKSKITHLIVCTTSGVDMPGADYQLTKLLGLRPYVKRY 157
Query: 62 FNVNNNCSTGSSALMLAKQFIESGSDCT-LALGFEKM 97
C G + L LAK E+ L + E
Sbjct: 158 MMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEVT 194
|
| >d1u0ma1 c.95.1.2 (A:2-201) Putative polyketide synthase SCO1206 {Streptomyces coelicolor [TaxId: 1902]} Length = 200 | Back information, alignment and structure |
|---|
| >d1ulqa1 c.95.1.1 (A:3-275) Beta-ketoadipyl CoA thiolase {Thermus thermophilus [TaxId: 274]} Length = 273 | Back information, alignment and structure |
|---|
| >d1teda_ c.95.1.2 (A:) Polyketide synthase PKS18 {Mycobacterium tuberculosis [TaxId: 1773]} Length = 372 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 110 | |||
| d1hnja1 | 174 | Ketoacyl-ACP synthase III (FabH) {Escherichia coli | 99.82 | |
| d1ulqa1 | 273 | Beta-ketoadipyl CoA thiolase {Thermus thermophilus | 99.82 | |
| d1u6ea1 | 184 | Ketoacyl-ACP synthase III (FabH) {Mycobacterium tu | 99.81 | |
| d1mzja1 | 181 | Priming beta-ketosynthase from the r1128 polyketid | 99.8 | |
| d1m3ka1 | 268 | Biosynthetic thiolase {Zoogloea ramigera [TaxId: 3 | 99.8 | |
| d1ub7a1 | 172 | Ketoacyl-ACP synthase III (FabH) {Thermus thermoph | 99.8 | |
| d1wdkc1 | 262 | Fatty oxidation complex beta subunit (3-ketoacyl-C | 99.78 | |
| d1u0ma1 | 200 | Putative polyketide synthase SCO1206 {Streptomyces | 99.7 | |
| d1afwa1 | 269 | Thiolase {Baker's yeast (Saccharomyces cerevisiae) | 99.7 | |
| d1bi5a1 | 235 | Chalcone synthase {Alfalfa (Medicago sativa) [TaxI | 99.65 | |
| d1teda_ | 372 | Polyketide synthase PKS18 {Mycobacterium tuberculo | 99.62 | |
| d1xpma1 | 166 | 3-hydroxy-3-methylglutaryl CoA synthase MvaS {Stap | 99.56 | |
| d1j3na1 | 249 | Beta-ketoacyl-ACP synthase II {Thermus thermophilu | 99.55 | |
| d2gfva1 | 250 | Beta-ketoacyl-ACP synthase II {Escherichia coli [T | 99.49 | |
| d1tqyb1 | 208 | Actinorhodin polyketide putative beta-ketoacyl syn | 99.49 | |
| d1tqya1 | 216 | Actinorhodin polyketide putative beta-ketoacyl syn | 99.49 | |
| d1ox0a1 | 256 | Beta-ketoacyl-ACP synthase II {Streptococcus pneum | 99.45 | |
| d1e5ma1 | 250 | Beta-ketoacyl-ACP synthase II {Synechocystis sp. [ | 99.38 | |
| d2vbaa1 | 253 | Beta-ketoacyl-ACP synthase I {Escherichia coli [Ta | 99.16 | |
| d2ix4a1 | 270 | Beta-ketoacyl-ACP synthase II {Thale cress (Arabid | 99.01 | |
| d1ub7a2 | 149 | Ketoacyl-ACP synthase III (FabH) {Thermus thermoph | 96.74 | |
| d1u6ea2 | 148 | Ketoacyl-ACP synthase III (FabH) {Mycobacterium tu | 96.67 | |
| d1hnja2 | 143 | Ketoacyl-ACP synthase III (FabH) {Escherichia coli | 96.47 | |
| d1mzja2 | 153 | Priming beta-ketosynthase from the r1128 polyketid | 95.76 | |
| d1tqyb2 | 194 | Actinorhodin polyketide putative beta-ketoacyl syn | 94.4 | |
| d1ox0a2 | 158 | Beta-ketoacyl-ACP synthase II {Streptococcus pneum | 94.24 | |
| d1xhoa_ | 112 | Chorismate mutase {Clostridium thermocellum [TaxId | 93.55 | |
| d1okja1 | 106 | Hypothetical protein YeaZ {Escherichia coli [TaxId | 92.91 | |
| d2a6aa1 | 103 | Hypothetical protein TM0874 {Thermotoga maritima [ | 92.49 | |
| d1ufya_ | 121 | Chorismate mutase {Thermus thermophilus [TaxId: 27 | 91.27 | |
| d1teda_ | 372 | Polyketide synthase PKS18 {Mycobacterium tuberculo | 90.65 | |
| d1dbfa_ | 127 | Chorismate mutase {Bacillus subtilis [TaxId: 1423] | 90.47 | |
| d1u0ma2 | 148 | Putative polyketide synthase SCO1206 {Streptomyces | 89.72 | |
| d1e5ma2 | 161 | Beta-ketoacyl-ACP synthase II {Synechocystis sp. [ | 88.39 | |
| d1afwa2 | 124 | Thiolase {Baker's yeast (Saccharomyces cerevisiae) | 88.13 | |
| d1ulqa2 | 125 | Beta-ketoadipyl CoA thiolase {Thermus thermophilus | 87.76 | |
| d1wdkc2 | 128 | Fatty oxidation complex beta subunit (3-ketoacyl-C | 86.57 | |
| d1m3ka2 | 124 | Biosynthetic thiolase {Zoogloea ramigera [TaxId: 3 | 86.47 | |
| d1j3na2 | 159 | Beta-ketoacyl-ACP synthase II {Thermus thermophilu | 85.81 | |
| d2gfva2 | 161 | Beta-ketoacyl-ACP synthase II {Escherichia coli [T | 85.62 | |
| d1tqya2 | 205 | Actinorhodin polyketide putative beta-ketoacyl syn | 85.03 | |
| d2ix4a2 | 161 | Beta-ketoacyl-ACP synthase II {Thale cress (Arabid | 83.13 |
| >d1hnja1 c.95.1.2 (A:1-174) Ketoacyl-ACP synthase III (FabH) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Thiolase-like superfamily: Thiolase-like family: Chalcone synthase-like domain: Ketoacyl-ACP synthase III (FabH) species: Escherichia coli [TaxId: 562]
Probab=99.82 E-value=6.4e-20 Score=118.17 Aligned_cols=97 Identities=22% Similarity=0.350 Sum_probs=88.4
Q ss_pred CCCCHHHHHHHHHHHHHHHcCCCccccCeEEEEeecCCCcch---hHHHHHcCCCCCCeeeEeccchHHHHHHHHHHHHH
Q psy13271 6 EDTDYPELAKEALIKALDDAGISINQVQQACCGYVYGDSTCG---QRALYQIGMTGIPVFNVNNNCSTGSSALMLAKQFI 82 (110)
Q Consensus 6 ~~~~~~~l~~~a~~~al~~agl~~~~id~vi~~~~~~~~~~~---~~~a~~lg~~~~~~~~i~~~C~sg~~al~~A~~~i 82 (110)
++++..+|+.+|++++|+++++++++||.|++++.++++..| ..+++.||+++.++++++.+|++++.+|.+|..++
T Consensus 47 ~~~~~~~la~~Aa~~al~~a~~~~~~Id~li~~s~~~~~~~P~~a~~v~~~Lgl~~~~~~di~~~C~g~~~al~~A~~~i 126 (174)
T d1hnja1 47 PNETVSTMGFEAATRAIEMAGIEKDQIGLIVVATTSATHAFPSAACQIQSMLGIKGCPAFDVAAACAGFTYALSVADQYV 126 (174)
T ss_dssp TTCCHHHHHHHHHHHHHHHHTCCGGGCCEEEEECSCCSCSSSCHHHHHHHHHTCCSSCEEEECCGGGHHHHHHHHHHHHH
T ss_pred CCccchHHHHHHHHHhhhhcccccccccEEEEecCCccccccchhhhhhhccCCCchhhhhhhhhhccHHHHHHHHHHHH
Confidence 578999999999999999999999999999999998887544 35778999988899999999999999999999999
Q ss_pred HcC-CCeEEEEeeccCCCCCC
Q psy13271 83 ESG-SDCTLALGFEKMEKGSL 102 (110)
Q Consensus 83 ~sG-~~~vlv~g~e~~s~~~~ 102 (110)
++| ++++|++++|..|+...
T Consensus 127 ~sg~~~~~Lvv~~e~~S~~~~ 147 (174)
T d1hnja1 127 KSGAVKYALVVGSDVLARTCD 147 (174)
T ss_dssp HTTSCSEEEEEEEECHHHHSC
T ss_pred hcCCcceeEEEeeehhhcccC
Confidence 999 99999999999876543
|
| >d1ulqa1 c.95.1.1 (A:3-275) Beta-ketoadipyl CoA thiolase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1mzja1 c.95.1.2 (A:3-183) Priming beta-ketosynthase from the r1128 polyketide biosynthetic pathway {Streptomyces sp. r1128 [TaxId: 140437]} | Back information, alignment and structure |
|---|
| >d1m3ka1 c.95.1.1 (A:1-268) Biosynthetic thiolase {Zoogloea ramigera [TaxId: 350]} | Back information, alignment and structure |
|---|
| >d1ub7a1 c.95.1.2 (A:2-173) Ketoacyl-ACP synthase III (FabH) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1wdkc1 c.95.1.1 (C:2-263) Fatty oxidation complex beta subunit (3-ketoacyl-CoA thiolase) {Pseudomonas fragi [TaxId: 296]} | Back information, alignment and structure |
|---|
| >d1u0ma1 c.95.1.2 (A:2-201) Putative polyketide synthase SCO1206 {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d1afwa1 c.95.1.1 (A:25-293) Thiolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1bi5a1 c.95.1.2 (A:1-235) Chalcone synthase {Alfalfa (Medicago sativa) [TaxId: 3879]} | Back information, alignment and structure |
|---|
| >d1teda_ c.95.1.2 (A:) Polyketide synthase PKS18 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1xpma1 c.95.1.2 (A:2-167) 3-hydroxy-3-methylglutaryl CoA synthase MvaS {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1j3na1 c.95.1.1 (A:1-249) Beta-ketoacyl-ACP synthase II {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2gfva1 c.95.1.1 (A:2-251) Beta-ketoacyl-ACP synthase II {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1tqyb1 c.95.1.1 (B:2-209) Actinorhodin polyketide putative beta-ketoacyl synthase 2, KasB {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d1tqya1 c.95.1.1 (A:3-218) Actinorhodin polyketide putative beta-ketoacyl synthase 1, KasA {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d1e5ma1 c.95.1.1 (A:6-255) Beta-ketoacyl-ACP synthase II {Synechocystis sp. [TaxId: 1143]} | Back information, alignment and structure |
|---|
| >d2vbaa1 c.95.1.1 (A:1-253) Beta-ketoacyl-ACP synthase I {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2ix4a1 c.95.1.1 (A:31-300) Beta-ketoacyl-ACP synthase II {Thale cress (Arabidopsis thaliana), mitochondrial isoform [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1ub7a2 c.95.1.2 (A:174-322) Ketoacyl-ACP synthase III (FabH) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1u6ea2 c.95.1.2 (A:175-317) Ketoacyl-ACP synthase III (FabH) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1hnja2 c.95.1.2 (A:175-317) Ketoacyl-ACP synthase III (FabH) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1mzja2 c.95.1.2 (A:184-336) Priming beta-ketosynthase from the r1128 polyketide biosynthetic pathway {Streptomyces sp. r1128 [TaxId: 140437]} | Back information, alignment and structure |
|---|
| >d1tqyb2 c.95.1.1 (B:210-403) Actinorhodin polyketide putative beta-ketoacyl synthase 2, KasB {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d1ox0a2 c.95.1.1 (A:252-409) Beta-ketoacyl-ACP synthase II {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1xhoa_ d.79.1.2 (A:) Chorismate mutase {Clostridium thermocellum [TaxId: 1515]} | Back information, alignment and structure |
|---|
| >d1okja1 c.55.1.9 (A:1-106) Hypothetical protein YeaZ {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2a6aa1 c.55.1.9 (A:1-103) Hypothetical protein TM0874 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ufya_ d.79.1.2 (A:) Chorismate mutase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1teda_ c.95.1.2 (A:) Polyketide synthase PKS18 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1dbfa_ d.79.1.2 (A:) Chorismate mutase {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1u0ma2 c.95.1.2 (A:202-349) Putative polyketide synthase SCO1206 {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d1e5ma2 c.95.1.1 (A:256-416) Beta-ketoacyl-ACP synthase II {Synechocystis sp. [TaxId: 1143]} | Back information, alignment and structure |
|---|
| >d1afwa2 c.95.1.1 (A:294-417) Thiolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ulqa2 c.95.1.1 (A:276-400) Beta-ketoadipyl CoA thiolase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1wdkc2 c.95.1.1 (C:264-391) Fatty oxidation complex beta subunit (3-ketoacyl-CoA thiolase) {Pseudomonas fragi [TaxId: 296]} | Back information, alignment and structure |
|---|
| >d1m3ka2 c.95.1.1 (A:269-392) Biosynthetic thiolase {Zoogloea ramigera [TaxId: 350]} | Back information, alignment and structure |
|---|
| >d1j3na2 c.95.1.1 (A:250-408) Beta-ketoacyl-ACP synthase II {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2gfva2 c.95.1.1 (A:252-412) Beta-ketoacyl-ACP synthase II {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1tqya2 c.95.1.1 (A:219-423) Actinorhodin polyketide putative beta-ketoacyl synthase 1, KasA {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d2ix4a2 c.95.1.1 (A:301-461) Beta-ketoacyl-ACP synthase II {Thale cress (Arabidopsis thaliana), mitochondrial isoform [TaxId: 3702]} | Back information, alignment and structure |
|---|