Psyllid ID: psy13271


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110
FQKPKEDTDYPELAKEALIKALDDAGISINQVQQACCGYVYGDSTCGQRALYQIGMTGIPVFNVNNNCSTGSSALMLAKQFIESGSDCTLALGFEKMEKGSLGAKSKPVK
cccccccccHHHHHHHHHHHHHHHcccccccccEEEEEEEcccccHHHHHHHHHcccccccEEEEcccccHHHHHHHHHHHHHccccEEEEEEEcccccccccccccccc
cccccccccHHHHHHHHHHHHHHHccccHHHHHEEEEEEEEccccccHHEEEEEcccccEEEEcccccccHHHHHHHHHHHHHccccEEEEEEEcccccccccccccccc
fqkpkedtdypELAKEALIKALDDAGISINQVQQACcgyvygdstcgqRALYQIGmtgipvfnvnnncstgsSALMLAKQFIESGSDCTLALGFEkmekgslgakskpvk
fqkpkedtdypELAKEALIKALDDAGISINQVQQACCGYVYGDSTCGQRALYQIGMTGIPVFNVNNNCSTGSSALMLAKQFIESGSDCTLALGFEkmekgslgakskpvk
FQKPKEDTDYPELAKEALIKALDDAGISINQVQQACCGYVYGDSTCGQRALYQIGMTGIPVFNVNNNCSTGSSALMLAKQFIESGSDCTLALGFEKMEKGSLGAKSKPVK
***************EALIKALDDAGISINQVQQACCGYVYGDSTCGQRALYQIGMTGIPVFNVNNNCSTGSSALMLAKQFIESGSDCTLALGF****************
*Q*P**DTDYPELAKEALIKALDDAGISINQVQQACCGYVYGDSTCGQRALYQIGMTGIPVFNVNNNCSTGSSALMLAKQFIESGSDCTLALGFEKME************
**********PELAKEALIKALDDAGISINQVQQACCGYVYGDSTCGQRALYQIGMTGIPVFNVNNNCSTGSSALMLAKQFIESGSDCTLALGFEKME************
F***KEDTDYPELAKEALIKALDDAGISINQVQQACCGYVYGDSTCGQRALYQIGMTGIPVFNVNNNCSTGSSALMLAKQFIESGSDCTLALGFEKM*************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
FQKPKEDTDYPELAKEALIKALDDAGISINQVQQACCGYVYGDSTCGQRALYQIGMTGIPVFNVNNNCSTGSSALMLAKQFIESGSDCTLALGFEKMEKGSLGAKSKPVK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query110 2.2.26 [Sep-21-2011]
Q07598 547 Non-specific lipid-transf yes N/A 0.945 0.190 0.644 3e-34
O62742 547 Non-specific lipid-transf yes N/A 0.954 0.191 0.642 2e-33
P11915 547 Non-specific lipid-transf yes N/A 0.954 0.191 0.633 1e-32
P32020 547 Non-specific lipid-transf yes N/A 0.954 0.191 0.623 1e-32
P22307 547 Non-specific lipid-transf yes N/A 0.954 0.191 0.633 3e-32
P07857 543 Non-specific lipid-transf yes N/A 0.990 0.200 0.603 1e-31
>sp|Q07598|NLTP_CHICK Non-specific lipid-transfer protein (Fragment) OS=Gallus gallus GN=SCP2 PE=2 SV=1 Back     alignment and function desciption
 Score =  143 bits (360), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 87/107 (81%), Gaps = 3/107 (2%)

Query: 1   FQKPKEDT-DYPELAKEALIKALDDAGISINQVQQACCGYVYGDSTCGQRALYQ-IGMTG 58
           F KP E++ DYP+LAKEA  KAL DAGI  + V+QAC GYVYGDSTCGQRA+Y  +G+TG
Sbjct: 28  FAKPSENSVDYPDLAKEAGQKALADAGIPYSAVEQACVGYVYGDSTCGQRAIYHGLGLTG 87

Query: 59  IPVFNVNNNCSTGSSALMLAKQFIESG-SDCTLALGFEKMEKGSLGA 104
           IP+ NVNNNC+TGS+AL +++Q +E G +DC LALGFE+M KGSL +
Sbjct: 88  IPIINVNNNCATGSTALFMSRQLVEGGLADCVLALGFERMAKGSLAS 134




Mediates in vitro the transfer of all common phospholipids, cholesterol and gangliosides between membranes. May play a role in regulating steroidogenesis.
Gallus gallus (taxid: 9031)
EC: 2EC: .EC: 3EC: .EC: 1EC: .EC: 1EC: 7EC: 6
>sp|O62742|NLTP_RABIT Non-specific lipid-transfer protein OS=Oryctolagus cuniculus GN=SCP2 PE=1 SV=1 Back     alignment and function description
>sp|P11915|NLTP_RAT Non-specific lipid-transfer protein OS=Rattus norvegicus GN=Scp2 PE=1 SV=3 Back     alignment and function description
>sp|P32020|NLTP_MOUSE Non-specific lipid-transfer protein OS=Mus musculus GN=Scp2 PE=1 SV=3 Back     alignment and function description
>sp|P22307|NLTP_HUMAN Non-specific lipid-transfer protein OS=Homo sapiens GN=SCP2 PE=1 SV=2 Back     alignment and function description
>sp|P07857|NLTP_BOVIN Non-specific lipid-transfer protein OS=Bos taurus GN=SCP2 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query110
449670340 576 PREDICTED: non-specific lipid-transfer p 0.954 0.182 0.703 6e-39
282165699 538 Sterol carrier protein X-related thiolas 0.954 0.195 0.700 1e-38
125985805 544 GA25964 [Drosophila pseudoobscura pseudo 0.954 0.193 0.740 2e-38
194760231 407 GF14486 [Drosophila ananassae] gi|190616 0.954 0.257 0.731 2e-38
195147962 544 GL19449 [Drosophila persimilis] gi|19410 0.954 0.193 0.740 2e-38
194760233 544 GF15421 [Drosophila ananassae] gi|190616 0.954 0.193 0.731 2e-38
198428552 396 PREDICTED: similar to sterol carrier pro 0.927 0.257 0.723 4e-38
194879982 407 GG21682 [Drosophila erecta] gi|190657528 0.954 0.257 0.722 4e-38
195579984 407 GD21807 [Drosophila simulans] gi|1941918 0.954 0.257 0.722 4e-38
170036555 544 nonspecific lipid-transfer protein [Cule 0.954 0.193 0.722 4e-38
>gi|449670340|ref|XP_002165358.2| PREDICTED: non-specific lipid-transfer protein-like, partial [Hydra magnipapillata] Back     alignment and taxonomy information
 Score =  164 bits (415), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 76/108 (70%), Positives = 94/108 (87%), Gaps = 3/108 (2%)

Query: 1   FQKP--KEDTDYPELAKEALIKALDDAGISINQVQQACCGYVYGDSTCGQRALYQIGMTG 58
           F+KP  ++D DYP + KEA+ +AL+DAGI+ N++QQA CGYVYGDSTCGQRALYQ G+TG
Sbjct: 1   FEKPGARKDFDYPVMVKEAVTQALNDAGITYNEIQQAVCGYVYGDSTCGQRALYQFGLTG 60

Query: 59  IPVFNVNNNCSTGSSALMLAKQFIESGS-DCTLALGFEKMEKGSLGAK 105
           IP+ NVNNNCSTGSSAL++AKQ IE G+ DC LA+GFEKME+GSLG+K
Sbjct: 61  IPILNVNNNCSTGSSALLMAKQLIEGGTADCVLAVGFEKMERGSLGSK 108




Source: Hydra magnipapillata

Species: Hydra magnipapillata

Genus: Hydra

Family: Hydridae

Order: Hydroida

Class: Hydrozoa

Phylum: Cnidaria

Superkingdom: Eukaryota

>gi|282165699|ref|NP_001107796.2| Sterol carrier protein X-related thiolase [Tribolium castaneum] gi|270015166|gb|EFA11614.1| sterol carrier protein x [Tribolium castaneum] Back     alignment and taxonomy information
>gi|125985805|ref|XP_001356666.1| GA25964 [Drosophila pseudoobscura pseudoobscura] gi|54644991|gb|EAL33731.1| GA25964 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information
>gi|194760231|ref|XP_001962345.1| GF14486 [Drosophila ananassae] gi|190616042|gb|EDV31566.1| GF14486 [Drosophila ananassae] Back     alignment and taxonomy information
>gi|195147962|ref|XP_002014943.1| GL19449 [Drosophila persimilis] gi|194106896|gb|EDW28939.1| GL19449 [Drosophila persimilis] Back     alignment and taxonomy information
>gi|194760233|ref|XP_001962346.1| GF15421 [Drosophila ananassae] gi|190616043|gb|EDV31567.1| GF15421 [Drosophila ananassae] Back     alignment and taxonomy information
>gi|198428552|ref|XP_002120864.1| PREDICTED: similar to sterol carrier protein 2 [Ciona intestinalis] Back     alignment and taxonomy information
>gi|194879982|ref|XP_001974341.1| GG21682 [Drosophila erecta] gi|190657528|gb|EDV54741.1| GG21682 [Drosophila erecta] Back     alignment and taxonomy information
>gi|195579984|ref|XP_002079836.1| GD21807 [Drosophila simulans] gi|194191845|gb|EDX05421.1| GD21807 [Drosophila simulans] Back     alignment and taxonomy information
>gi|170036555|ref|XP_001846129.1| nonspecific lipid-transfer protein [Culex quinquefasciatus] gi|167879197|gb|EDS42580.1| nonspecific lipid-transfer protein [Culex quinquefasciatus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms


Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q07598NLTP_CHICK2, ., 3, ., 1, ., 1, 7, 60.64480.94540.1901yesN/A
P32020NLTP_MOUSE2, ., 3, ., 1, ., 1, 7, 60.62380.95450.1919yesN/A
P22307NLTP_HUMAN2, ., 3, ., 1, ., 1, 7, 60.63300.95450.1919yesN/A
P11915NLTP_RAT2, ., 3, ., 1, ., 1, 7, 60.63300.95450.1919yesN/A
P07857NLTP_BOVIN2, ., 3, ., 1, ., 1, 7, 60.60340.99090.2007yesN/A
O62742NLTP_RABIT2, ., 3, ., 1, ., 1, 7, 60.64220.95450.1919yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query110
PRK08256 391 PRK08256, PRK08256, lipid-transfer protein; Provis 3e-61
cd00829 375 cd00829, SCP-x_thiolase, Thiolase domain associate 1e-30
cd00826 393 cd00826, nondecarbox_cond_enzymes, nondecarboxylat 1e-22
cd00327 254 cd00327, cond_enzymes, Condensing enzymes; Family 3e-20
COG0183 392 COG0183, PaaJ, Acetyl-CoA acetyltransferase [Lipid 1e-13
PRK06064 389 PRK06064, PRK06064, acetyl-CoA acetyltransferase; 3e-11
PRK06157 398 PRK06157, PRK06157, acetyl-CoA acetyltransferase; 2e-10
cd00751 386 cd00751, thiolase, Thiolase are ubiquitous enzymes 4e-08
PRK12578 385 PRK12578, PRK12578, acetyl-CoA acetyltransferase; 2e-07
cd00827 324 cd00827, init_cond_enzymes, "initiating" condensin 3e-07
COG0332 323 COG0332, FabH, 3-oxoacyl-[acyl-carrier-protein] 4e-07
PRK06365 430 PRK06365, PRK06365, acetyl-CoA acetyltransferase; 4e-07
PRK06059 399 PRK06059, PRK06059, lipid-transfer protein; Provis 8e-06
pfam00108 262 pfam00108, Thiolase_N, Thiolase, N-terminal domain 1e-05
cd00830 320 cd00830, KAS_III, Ketoacyl-acyl carrier protein sy 1e-05
TIGR00747 318 TIGR00747, fabH, 3-oxoacyl-(acyl-carrier-protein) 2e-05
PRK07516 389 PRK07516, PRK07516, acetyl-CoA acetyltransferase; 2e-05
PRK05790 393 PRK05790, PRK05790, putative acyltransferase; Prov 4e-05
PLN02644 394 PLN02644, PLN02644, acetyl-CoA C-acetyltransferase 5e-05
PRK06289 403 PRK06289, PRK06289, acetyl-CoA acetyltransferase; 8e-05
TIGR01930 386 TIGR01930, AcCoA-C-Actrans, acetyl-CoA acetyltrans 2e-04
PRK09352 319 PRK09352, PRK09352, 3-oxoacyl-(acyl carrier protei 3e-04
CHL00203 326 CHL00203, fabH, 3-oxoacyl-acyl-carrier-protein syn 0.002
PRK08313 386 PRK08313, PRK08313, acetyl-CoA acetyltransferase; 0.003
PRK06366 388 PRK06366, PRK06366, acetyl-CoA acetyltransferase; 0.003
>gnl|CDD|181327 PRK08256, PRK08256, lipid-transfer protein; Provisional Back     alignment and domain information
 Score =  191 bits (487), Expect = 3e-61
 Identities = 68/106 (64%), Positives = 83/106 (78%), Gaps = 1/106 (0%)

Query: 1   FQKPKEDTDYPELAKEALIKALDDAGISINQVQQACCGYVYGDSTCGQRALYQIGMTGIP 60
           F+KP    DYP++A EA   AL DAGI  + VQQA  GYVYGDST GQRALY++GMTGIP
Sbjct: 13  FEKPGASWDYPDMAAEAGRAALADAGIDYDAVQQAYVGYVYGDSTSGQRALYEVGMTGIP 72

Query: 61  VFNVNNNCSTGSSALMLAKQFIESG-SDCTLALGFEKMEKGSLGAK 105
           + NVNNNCSTGS+AL LA+Q + SG +DC LALGFE+M+ G+LG+ 
Sbjct: 73  IVNVNNNCSTGSTALFLARQAVRSGAADCALALGFEQMQPGALGSV 118


Length = 391

>gnl|CDD|238425 cd00829, SCP-x_thiolase, Thiolase domain associated with sterol carrier protein (SCP)-x isoform and related proteins; SCP-2 has multiple roles in intracellular lipid circulation and metabolism Back     alignment and domain information
>gnl|CDD|238422 cd00826, nondecarbox_cond_enzymes, nondecarboxylating condensing enzymes; In general, thiolases catalyze the reversible thiolytic cleavage of 3-ketoacyl-CoA into acyl-CoA and acetyl-CoA, a 2-step reaction involving a covalent intermediate formed with a catalytic cysteine Back     alignment and domain information
>gnl|CDD|238201 cd00327, cond_enzymes, Condensing enzymes; Family of enzymes that catalyze a (decarboxylating or non-decarboxylating) Claisen-like condensation reaction Back     alignment and domain information
>gnl|CDD|223261 COG0183, PaaJ, Acetyl-CoA acetyltransferase [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|235688 PRK06064, PRK06064, acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|180433 PRK06157, PRK06157, acetyl-CoA acetyltransferase; Validated Back     alignment and domain information
>gnl|CDD|238383 cd00751, thiolase, Thiolase are ubiquitous enzymes that catalyze the reversible thiolytic cleavage of 3-ketoacyl-CoA into acyl-CoA and acetyl-CoA, a 2-step reaction involving a covalent intermediate formed with a catalytic cysteine Back     alignment and domain information
>gnl|CDD|183606 PRK12578, PRK12578, acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|238423 cd00827, init_cond_enzymes, "initiating" condensing enzymes are a subclass of decarboxylating condensing enzymes, including beta-ketoacyl [ACP] synthase, type III and polyketide synthases, type III, which include chalcone synthase and related enzymes Back     alignment and domain information
>gnl|CDD|223409 COG0332, FabH, 3-oxoacyl-[acyl-carrier-protein] Back     alignment and domain information
>gnl|CDD|235785 PRK06365, PRK06365, acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|180373 PRK06059, PRK06059, lipid-transfer protein; Provisional Back     alignment and domain information
>gnl|CDD|215722 pfam00108, Thiolase_N, Thiolase, N-terminal domain Back     alignment and domain information
>gnl|CDD|238426 cd00830, KAS_III, Ketoacyl-acyl carrier protein synthase III (KASIII) initiates the elongation in type II fatty acid synthase systems Back     alignment and domain information
>gnl|CDD|233113 TIGR00747, fabH, 3-oxoacyl-(acyl-carrier-protein) synthase III Back     alignment and domain information
>gnl|CDD|181013 PRK07516, PRK07516, acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|180261 PRK05790, PRK05790, putative acyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|215347 PLN02644, PLN02644, acetyl-CoA C-acetyltransferase Back     alignment and domain information
>gnl|CDD|235771 PRK06289, PRK06289, acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|233642 TIGR01930, AcCoA-C-Actrans, acetyl-CoA acetyltransferases Back     alignment and domain information
>gnl|CDD|236475 PRK09352, PRK09352, 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>gnl|CDD|164577 CHL00203, fabH, 3-oxoacyl-acyl-carrier-protein synthase 3; Provisional Back     alignment and domain information
>gnl|CDD|181378 PRK08313, PRK08313, acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|102340 PRK06366, PRK06366, acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 110
COG0332 323 FabH 3-oxoacyl-[acyl-carrier-protein] 99.84
PRK08235 393 acetyl-CoA acetyltransferase; Provisional 99.81
PF00108 264 Thiolase_N: Thiolase, N-terminal domain; InterPro: 99.81
PRK05656 393 acetyl-CoA acetyltransferase; Provisional 99.8
PRK07108 392 acetyl-CoA acetyltransferase; Provisional 99.8
PRK09051 394 beta-ketothiolase; Provisional 99.79
PRK07850 387 acetyl-CoA acetyltransferase; Provisional 99.79
PRK06205 404 acetyl-CoA acetyltransferase; Provisional 99.79
PRK12578 385 acetyl-CoA acetyltransferase; Provisional 99.79
PRK08242 402 acetyl-CoA acetyltransferase; Validated 99.79
cd00751 386 thiolase Thiolase are ubiquitous enzymes that cata 99.78
PRK08131 401 acetyl-CoA acetyltransferase; Provisional 99.78
PRK09052 399 acetyl-CoA acetyltransferase; Provisional 99.78
PRK08963 428 fadI 3-ketoacyl-CoA thiolase; Reviewed 99.77
PRK06157 398 acetyl-CoA acetyltransferase; Validated 99.77
PRK13359 400 beta-ketoadipyl CoA thiolase; Provisional 99.77
PRK06954 397 acetyl-CoA acetyltransferase; Provisional 99.76
TIGR02446 430 FadI fatty oxidation complex, beta subunit FadI. T 99.76
PRK06504 390 acetyl-CoA acetyltransferase; Provisional 99.75
PRK06633 392 acetyl-CoA acetyltransferase; Provisional 99.75
cd00829 375 SCP-x_thiolase Thiolase domain associated with ste 99.75
TIGR01930 386 AcCoA-C-Actrans acetyl-CoA acetyltransferases. Thi 99.75
PRK09050 401 beta-ketoadipyl CoA thiolase; Validated 99.75
TIGR02845 327 spore_V_AD stage V sporulation protein AD. Bacillu 99.75
PRK08256 391 lipid-transfer protein; Provisional 99.75
PLN02287 452 3-ketoacyl-CoA thiolase 99.75
PRK07661 391 acetyl-CoA acetyltransferase; Provisional 99.74
PRK05790 393 putative acyltransferase; Provisional 99.74
TIGR02430 400 pcaF beta-ketoadipyl CoA thiolase. Members of this 99.74
PTZ00455 438 3-ketoacyl-CoA thiolase; Provisional 99.74
PRK08313 386 acetyl-CoA acetyltransferase; Provisional 99.74
PRK06366 388 acetyl-CoA acetyltransferase; Provisional 99.74
PRK07516 389 acetyl-CoA acetyltransferase; Provisional 99.74
PRK08170 426 acetyl-CoA acetyltransferase; Provisional 99.74
cd00826 393 nondecarbox_cond_enzymes nondecarboxylating conden 99.73
PRK07851 406 acetyl-CoA acetyltransferase; Provisional 99.73
PRK06289 403 acetyl-CoA acetyltransferase; Provisional 99.73
PRK08304 337 stage V sporulation protein AD; Validated 99.73
PRK06064 389 acetyl-CoA acetyltransferase; Provisional 99.73
CHL00203 326 fabH 3-oxoacyl-acyl-carrier-protein synthase 3; Pr 99.73
PRK06365 430 acetyl-CoA acetyltransferase; Provisional 99.73
PRK06065 392 acetyl-CoA acetyltransferase; Provisional 99.72
PRK12879 325 3-oxoacyl-(acyl carrier protein) synthase III; Rev 99.72
PRK06059 399 lipid-transfer protein; Provisional 99.71
PRK06816 378 3-oxoacyl-(acyl carrier protein) synthase III; Rev 99.71
PLN02326 379 3-oxoacyl-[acyl-carrier-protein] synthase III 99.71
PRK05963 326 3-oxoacyl-(acyl carrier protein) synthase II; Revi 99.71
PRK12880 353 3-oxoacyl-(acyl carrier protein) synthase III; Rev 99.71
PRK09258 338 3-oxoacyl-(acyl carrier protein) synthase III; Rev 99.71
PRK09352 319 3-oxoacyl-(acyl carrier protein) synthase III; Rev 99.71
PLN02644 394 acetyl-CoA C-acetyltransferase 99.7
TIGR00748 345 HMG_CoA_syn_Arc hydroxymethylglutaryl-CoA synthase 99.7
PRK09268 427 acetyl-CoA acetyltransferase; Provisional 99.7
PRK07204 329 3-oxoacyl-(acyl carrier protein) synthase III; Rev 99.7
TIGR00747 318 fabH 3-oxoacyl-(acyl-carrier-protein) synthase III 99.69
PRK06025 417 acetyl-CoA acetyltransferase; Provisional 99.69
PRK06445 394 acetyl-CoA acetyltransferase; Provisional 99.69
TIGR02445 385 fadA fatty oxidation complex, beta subunit FadA. T 99.68
cd00830 320 KAS_III Ketoacyl-acyl carrier protein synthase III 99.68
PRK08947 387 fadA 3-ketoacyl-CoA thiolase; Reviewed 99.68
PRK06158 384 thiolase; Provisional 99.67
cd00827 324 init_cond_enzymes "initiating" condensing enzymes 99.66
PRK07801 382 acetyl-CoA acetyltransferase; Provisional 99.65
PLN03168 389 chalcone synthase; Provisional 99.65
PLN02932 478 3-ketoacyl-CoA synthase 99.65
PRK04262 347 hypothetical protein; Provisional 99.65
PRK12404 334 stage V sporulation protein AD; Provisional 99.65
cd00327 254 cond_enzymes Condensing enzymes; Family of enzymes 99.64
PRK06690 361 acetyl-CoA acetyltransferase; Provisional 99.64
PRK06840 339 hypothetical protein; Validated 99.63
PRK07515 372 3-oxoacyl-(acyl carrier protein) synthase III; Rev 99.62
PRK08142 388 acetyl-CoA acetyltransferase; Provisional 99.61
cd00831 361 CHS_like Chalcone and stilbene synthases; plant-sp 99.61
PLN02377 502 3-ketoacyl-CoA synthase 99.61
PLN02577 459 hydroxymethylglutaryl-CoA synthase 99.6
PLN03171 399 chalcone synthase-like protein; Provisional 99.6
PLN03169 391 chalcone synthase family protein; Provisional 99.58
PLN03170 401 chalcone synthase; Provisional 99.58
PLN03172 393 chalcone synthase family protein; Provisional 99.56
PLN03173 391 chalcone synthase; Provisional 99.56
PRK07855 386 lipid-transfer protein; Provisional 99.55
PLN02192 511 3-ketoacyl-CoA synthase 99.55
cd00825 332 decarbox_cond_enzymes decarboxylating condensing e 99.55
KOG1406|consensus 408 99.53
TIGR01835 379 HMG-CoA-S_prok 3-hydroxy-3-methylglutaryl CoA synt 99.53
PRK06066 385 acetyl-CoA acetyltransferase; Provisional 99.52
TIGR01833 454 HMG-CoA-S_euk 3-hydroxy-3-methylglutaryl-CoA-synth 99.52
COG0183 392 PaaJ Acetyl-CoA acetyltransferase [Lipid metabolis 99.51
PLN02854 521 3-ketoacyl-CoA synthase 99.5
PRK08257 498 acetyl-CoA acetyltransferase; Validated 99.5
smart00825 424 PKS_KS Beta-ketoacyl synthase. The structure of be 99.46
PLN00415 466 3-ketoacyl-CoA synthase 99.43
cd00834 406 KAS_I_II Beta-ketoacyl-acyl carrier protein (ACP) 99.42
KOG1390|consensus 396 99.42
KOG1391|consensus 396 99.42
PRK07314 411 3-oxoacyl-(acyl carrier protein) synthase II; Revi 99.4
cd00828 407 elong_cond_enzymes "elongating" condensing enzymes 99.39
PF08392 290 FAE1_CUT1_RppA: FAE1/Type III polyketide synthase- 99.39
PTZ00050 421 3-oxoacyl-acyl carrier protein synthase; Provision 99.39
TIGR03150 407 fabF beta-ketoacyl-acyl-carrier-protein synthase I 99.39
cd00833 421 PKS polyketide synthases (PKSs) polymerize simple 99.36
PRK06333 424 3-oxoacyl-(acyl carrier protein) synthase II; Revi 99.36
PF00195226 Chal_sti_synt_N: Chalcone and stilbene synthases, 99.34
PRK07937 352 lipid-transfer protein; Provisional 99.33
PRK08439 406 3-oxoacyl-(acyl carrier protein) synthase II; Revi 99.33
PF00109254 ketoacyl-synt: Beta-ketoacyl synthase, N-terminal 99.32
PRK08722 414 3-oxoacyl-(acyl carrier protein) synthase II; Revi 99.31
PLN02836 437 3-oxoacyl-[acyl-carrier-protein] synthase 99.3
PRK07967 406 3-oxoacyl-(acyl carrier protein) synthase I; Revie 99.28
PRK06147 348 3-oxoacyl-(acyl carrier protein) synthase; Validat 99.26
PRK06519 398 3-oxoacyl-(acyl carrier protein) synthase II; Revi 99.25
COG3425 377 PksG 3-hydroxy-3-methylglutaryl CoA synthase [Lipi 99.24
PRK14691 342 3-oxoacyl-(acyl carrier protein) synthase II; Prov 99.2
PLN02787 540 3-oxoacyl-[acyl-carrier-protein] synthase II 99.19
PRK09116 405 3-oxoacyl-(acyl carrier protein) synthase II; Revi 99.19
PRK07103 410 polyketide beta-ketoacyl:acyl carrier protein synt 99.16
PF01154174 HMG_CoA_synt_N: Hydroxymethylglutaryl-coenzyme A s 99.14
cd00832 399 CLF Chain-length factor (CLF) is a factor required 99.12
PRK06501 425 3-oxoacyl-(acyl carrier protein) synthase II; Revi 99.09
COG3321 1061 Polyketide synthase modules and related proteins [ 99.09
PRK07910 418 3-oxoacyl-(acyl carrier protein) synthase II; Revi 99.08
PRK05952 381 3-oxoacyl-(acyl carrier protein) synthase II; Revi 99.04
COG3424 356 BcsA Predicted naringenin-chalcone synthase [Secon 99.04
COG0304 412 FabB 3-oxoacyl-(acyl-carrier-protein) synthase [Li 99.01
KOG1389|consensus 435 99.01
KOG1392|consensus 465 98.98
TIGR02813 2582 omega_3_PfaA polyketide-type polyunsaturated fatty 98.97
KOG1394|consensus 440 98.96
PF07451 329 SpoVAD: Stage V sporulation protein AD (SpoVAD); I 98.91
PRK09185 392 3-oxoacyl-(acyl carrier protein) synthase I; Revie 98.7
PF0854580 ACP_syn_III: 3-Oxoacyl-[acyl-carrier-protein (ACP) 98.64
KOG1202|consensus 2376 98.53
PF13723218 Ketoacyl-synt_2: Beta-ketoacyl synthase, N-termina 97.26
KOG1393|consensus 462 97.01
PF0854190 ACP_syn_III_C: 3-Oxoacyl-[acyl-carrier-protein (AC 95.99
PRK06147348 3-oxoacyl-(acyl carrier protein) synthase; Validat 95.6
TIGR00748345 HMG_CoA_syn_Arc hydroxymethylglutaryl-CoA synthase 95.27
PF02801119 Ketoacyl-synt_C: Beta-ketoacyl synthase, C-termina 95.26
PRK06816378 3-oxoacyl-(acyl carrier protein) synthase III; Rev 94.64
PRK08257498 acetyl-CoA acetyltransferase; Validated 94.11
cd00832399 CLF Chain-length factor (CLF) is a factor required 93.99
PRK09258338 3-oxoacyl-(acyl carrier protein) synthase III; Rev 93.98
PRK07515372 3-oxoacyl-(acyl carrier protein) synthase III; Rev 93.88
PRK05963326 3-oxoacyl-(acyl carrier protein) synthase II; Revi 93.59
PRK04262347 hypothetical protein; Provisional 93.28
cd00834406 KAS_I_II Beta-ketoacyl-acyl carrier protein (ACP) 93.27
PRK05952381 3-oxoacyl-(acyl carrier protein) synthase II; Revi 93.25
PRK07204329 3-oxoacyl-(acyl carrier protein) synthase III; Rev 93.03
CHL00203326 fabH 3-oxoacyl-acyl-carrier-protein synthase 3; Pr 92.87
PRK06025417 acetyl-CoA acetyltransferase; Provisional 92.86
PRK06840339 hypothetical protein; Validated 92.62
PRK07910418 3-oxoacyl-(acyl carrier protein) synthase II; Revi 92.61
TIGR03150407 fabF beta-ketoacyl-acyl-carrier-protein synthase I 92.58
PRK06519398 3-oxoacyl-(acyl carrier protein) synthase II; Revi 92.28
PLN02326379 3-oxoacyl-[acyl-carrier-protein] synthase III 92.16
cd00828407 elong_cond_enzymes "elongating" condensing enzymes 92.09
PRK09185392 3-oxoacyl-(acyl carrier protein) synthase I; Revie 91.96
PLN02787540 3-oxoacyl-[acyl-carrier-protein] synthase II 91.92
PRK07314411 3-oxoacyl-(acyl carrier protein) synthase II; Revi 91.86
PRK08722414 3-oxoacyl-(acyl carrier protein) synthase II; Revi 91.85
PRK12879325 3-oxoacyl-(acyl carrier protein) synthase III; Rev 91.48
COG0304412 FabB 3-oxoacyl-(acyl-carrier-protein) synthase [Li 91.44
TIGR00747318 fabH 3-oxoacyl-(acyl-carrier-protein) synthase III 91.21
cd00830320 KAS_III Ketoacyl-acyl carrier protein synthase III 91.08
PRK05790393 putative acyltransferase; Provisional 91.07
PTZ00050421 3-oxoacyl-acyl carrier protein synthase; Provision 90.91
PRK09050401 beta-ketoadipyl CoA thiolase; Validated 90.87
TIGR01930386 AcCoA-C-Actrans acetyl-CoA acetyltransferases. Thi 90.86
COG1214220 Inactive homolog of metal-dependent proteases, put 90.82
PRK07103410 polyketide beta-ketoacyl:acyl carrier protein synt 90.62
PLN02287452 3-ketoacyl-CoA thiolase 90.61
PRK09051394 beta-ketothiolase; Provisional 90.46
PRK09052399 acetyl-CoA acetyltransferase; Provisional 90.44
PRK14691342 3-oxoacyl-(acyl carrier protein) synthase II; Prov 90.44
TIGR01796117 CM_mono_aroH monofunctional chorismate mutase, gra 90.32
PRK13359400 beta-ketoadipyl CoA thiolase; Provisional 90.18
PF02803123 Thiolase_C: Thiolase, C-terminal domain; InterPro: 90.14
PRK06690361 acetyl-CoA acetyltransferase; Provisional 90.12
PLN02836437 3-oxoacyl-[acyl-carrier-protein] synthase 89.92
PRK07937352 lipid-transfer protein; Provisional 89.77
PRK06333424 3-oxoacyl-(acyl carrier protein) synthase II; Revi 89.56
TIGR03285 445 methan_mark_14 putative methanogenesis marker prot 89.4
PF07736118 CM_1: Chorismate mutase type I; InterPro: IPR00824 89.38
TIGR02430400 pcaF beta-ketoadipyl CoA thiolase. Members of this 89.34
PRK09116405 3-oxoacyl-(acyl carrier protein) synthase II; Revi 89.23
PRK06501425 3-oxoacyl-(acyl carrier protein) synthase II; Revi 89.12
cd00833421 PKS polyketide synthases (PKSs) polymerize simple 88.91
PRK09352319 3-oxoacyl-(acyl carrier protein) synthase III; Rev 88.9
cd00825332 decarbox_cond_enzymes decarboxylating condensing e 88.74
smart00825424 PKS_KS Beta-ketoacyl synthase. The structure of be 88.66
cd00751386 thiolase Thiolase are ubiquitous enzymes that cata 87.76
COG0332323 FabH 3-oxoacyl-[acyl-carrier-protein] 87.64
PF00814 268 Peptidase_M22: Glycoprotease family; InterPro: IPR 87.43
PRK06205404 acetyl-CoA acetyltransferase; Provisional 87.26
PRK07661391 acetyl-CoA acetyltransferase; Provisional 87.24
PRK05656393 acetyl-CoA acetyltransferase; Provisional 87.17
cd00327254 cond_enzymes Condensing enzymes; Family of enzymes 87.03
TIGR03725202 bact_YeaZ universal bacterial protein YeaZ. This f 86.99
PRK08242402 acetyl-CoA acetyltransferase; Validated 86.8
KOG1394|consensus440 86.67
PRK07850387 acetyl-CoA acetyltransferase; Provisional 86.56
PRK06445394 acetyl-CoA acetyltransferase; Provisional 86.16
PRK06366388 acetyl-CoA acetyltransferase; Provisional 85.91
PRK06954397 acetyl-CoA acetyltransferase; Provisional 85.72
PRK12880353 3-oxoacyl-(acyl carrier protein) synthase III; Rev 85.29
cd02185117 AroH Chorismate mutase (AroH) is one of at least f 85.27
PRK08235393 acetyl-CoA acetyltransferase; Provisional 85.18
PRK07851406 acetyl-CoA acetyltransferase; Provisional 84.74
PF09887 448 DUF2114: Uncharacterized protein conserved in arch 84.37
PRK07801382 acetyl-CoA acetyltransferase; Provisional 84.23
PRK06158384 thiolase; Provisional 83.32
PF14574412 DUF4445: Domain of unknown function (DUF4445); PDB 83.28
PLN02644394 acetyl-CoA C-acetyltransferase 82.89
PRK09604 332 UGMP family protein; Validated 82.39
TIGR00329 305 gcp_kae1 metallohydrolase, glycoprotease/Kae1 fami 82.26
PRK06504390 acetyl-CoA acetyltransferase; Provisional 81.98
PRK06633392 acetyl-CoA acetyltransferase; Provisional 81.5
PRK08256391 lipid-transfer protein; Provisional 81.26
cd00831361 CHS_like Chalcone and stilbene synthases; plant-sp 81.2
PRK08304337 stage V sporulation protein AD; Validated 80.59
COG3425377 PksG 3-hydroxy-3-methylglutaryl CoA synthase [Lipi 80.51
TIGR02845327 spore_V_AD stage V sporulation protein AD. Bacillu 80.45
>COG0332 FabH 3-oxoacyl-[acyl-carrier-protein] Back     alignment and domain information
Probab=99.84  E-value=2.5e-20  Score=132.27  Aligned_cols=99  Identities=29%  Similarity=0.355  Sum_probs=91.0

Q ss_pred             CCCCHHHHHHHHHHHHHHHcCCCccccCeEEEEeecCCCcchh---HHHHHcCCCCCCeeeEeccchHHHHHHHHHHHHH
Q psy13271          6 EDTDYPELAKEALIKALDDAGISINQVQQACCGYVYGDSTCGQ---RALYQIGMTGIPVFNVNNNCSTGSSALMLAKQFI   82 (110)
Q Consensus         6 ~~~~~~~l~~~a~~~al~~agl~~~~id~vi~~~~~~~~~~~~---~~a~~lg~~~~~~~~i~~~C~sg~~al~~A~~~i   82 (110)
                      +++...+|+.+|+++||+++|++|+|||.||++++++++..|.   .++..||++++++|+++.+|++++.||..|..+|
T Consensus        48 ~~e~~s~la~~Aa~~AL~~Agi~~~dIDlII~aT~tpd~~~Ps~A~~vq~~LG~~~~~afDl~aaCsgf~yaL~~A~~~i  127 (323)
T COG0332          48 DDETTSDLAVEAARKALEDAGISPDDIDLIIVATSTPDHLFPSTACLVQARLGLGGAPAFDLQAACSGFLYALSVADGLI  127 (323)
T ss_pred             CCccHHHHHHHHHHHHHHHcCCCHHHCCEEEEEcCCcccCCChHHHHHHHHhCCCCcceeechhhhHHHHHHHHHHHHHH
Confidence            4789999999999999999999999999999999999987664   4678899988999999999999999999999999


Q ss_pred             HcC-CCeEEEEeeccCCCCCCCC
Q psy13271         83 ESG-SDCTLALGFEKMEKGSLGA  104 (110)
Q Consensus        83 ~sG-~~~vlv~g~e~~s~~~~~~  104 (110)
                      ++| ++++||+++|.+|+..-+.
T Consensus       128 ~sG~~k~vLVVg~e~~S~~ld~~  150 (323)
T COG0332         128 RSGGYKNVLVVGAETLSRILDWT  150 (323)
T ss_pred             HcCCCCEEEEEehhHhhccCCHh
Confidence            999 9999999999998775443



>PRK08235 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PF00108 Thiolase_N: Thiolase, N-terminal domain; InterPro: IPR020616 Two different types of thiolase [, , ] are found both in eukaryotes and in prokaryotes: acetoacetyl-CoA thiolase (2 Back     alignment and domain information
>PRK05656 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK07108 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK09051 beta-ketothiolase; Provisional Back     alignment and domain information
>PRK07850 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06205 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK12578 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK08242 acetyl-CoA acetyltransferase; Validated Back     alignment and domain information
>cd00751 thiolase Thiolase are ubiquitous enzymes that catalyze the reversible thiolytic cleavage of 3-ketoacyl-CoA into acyl-CoA and acetyl-CoA, a 2-step reaction involving a covalent intermediate formed with a catalytic cysteine Back     alignment and domain information
>PRK08131 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK09052 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK08963 fadI 3-ketoacyl-CoA thiolase; Reviewed Back     alignment and domain information
>PRK06157 acetyl-CoA acetyltransferase; Validated Back     alignment and domain information
>PRK13359 beta-ketoadipyl CoA thiolase; Provisional Back     alignment and domain information
>PRK06954 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>TIGR02446 FadI fatty oxidation complex, beta subunit FadI Back     alignment and domain information
>PRK06504 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06633 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>cd00829 SCP-x_thiolase Thiolase domain associated with sterol carrier protein (SCP)-x isoform and related proteins; SCP-2 has multiple roles in intracellular lipid circulation and metabolism Back     alignment and domain information
>TIGR01930 AcCoA-C-Actrans acetyl-CoA acetyltransferases Back     alignment and domain information
>PRK09050 beta-ketoadipyl CoA thiolase; Validated Back     alignment and domain information
>TIGR02845 spore_V_AD stage V sporulation protein AD Back     alignment and domain information
>PRK08256 lipid-transfer protein; Provisional Back     alignment and domain information
>PLN02287 3-ketoacyl-CoA thiolase Back     alignment and domain information
>PRK07661 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK05790 putative acyltransferase; Provisional Back     alignment and domain information
>TIGR02430 pcaF beta-ketoadipyl CoA thiolase Back     alignment and domain information
>PTZ00455 3-ketoacyl-CoA thiolase; Provisional Back     alignment and domain information
>PRK08313 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06366 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK07516 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK08170 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>cd00826 nondecarbox_cond_enzymes nondecarboxylating condensing enzymes; In general, thiolases catalyze the reversible thiolytic cleavage of 3-ketoacyl-CoA into acyl-CoA and acetyl-CoA, a 2-step reaction involving a covalent intermediate formed with a catalytic cysteine Back     alignment and domain information
>PRK07851 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06289 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK08304 stage V sporulation protein AD; Validated Back     alignment and domain information
>PRK06064 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>CHL00203 fabH 3-oxoacyl-acyl-carrier-protein synthase 3; Provisional Back     alignment and domain information
>PRK06365 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06065 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK12879 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>PRK06059 lipid-transfer protein; Provisional Back     alignment and domain information
>PRK06816 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>PLN02326 3-oxoacyl-[acyl-carrier-protein] synthase III Back     alignment and domain information
>PRK05963 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>PRK12880 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>PRK09258 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>PRK09352 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>PLN02644 acetyl-CoA C-acetyltransferase Back     alignment and domain information
>TIGR00748 HMG_CoA_syn_Arc hydroxymethylglutaryl-CoA synthase, putative Back     alignment and domain information
>PRK09268 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK07204 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>TIGR00747 fabH 3-oxoacyl-(acyl-carrier-protein) synthase III Back     alignment and domain information
>PRK06025 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06445 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>TIGR02445 fadA fatty oxidation complex, beta subunit FadA Back     alignment and domain information
>cd00830 KAS_III Ketoacyl-acyl carrier protein synthase III (KASIII) initiates the elongation in type II fatty acid synthase systems Back     alignment and domain information
>PRK08947 fadA 3-ketoacyl-CoA thiolase; Reviewed Back     alignment and domain information
>PRK06158 thiolase; Provisional Back     alignment and domain information
>cd00827 init_cond_enzymes "initiating" condensing enzymes are a subclass of decarboxylating condensing enzymes, including beta-ketoacyl [ACP] synthase, type III and polyketide synthases, type III, which include chalcone synthase and related enzymes Back     alignment and domain information
>PRK07801 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PLN03168 chalcone synthase; Provisional Back     alignment and domain information
>PLN02932 3-ketoacyl-CoA synthase Back     alignment and domain information
>PRK04262 hypothetical protein; Provisional Back     alignment and domain information
>PRK12404 stage V sporulation protein AD; Provisional Back     alignment and domain information
>cd00327 cond_enzymes Condensing enzymes; Family of enzymes that catalyze a (decarboxylating or non-decarboxylating) Claisen-like condensation reaction Back     alignment and domain information
>PRK06690 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06840 hypothetical protein; Validated Back     alignment and domain information
>PRK07515 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>PRK08142 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>cd00831 CHS_like Chalcone and stilbene synthases; plant-specific polyketide synthases (PKS) and related enzymes, also called type III PKSs Back     alignment and domain information
>PLN02377 3-ketoacyl-CoA synthase Back     alignment and domain information
>PLN02577 hydroxymethylglutaryl-CoA synthase Back     alignment and domain information
>PLN03171 chalcone synthase-like protein; Provisional Back     alignment and domain information
>PLN03169 chalcone synthase family protein; Provisional Back     alignment and domain information
>PLN03170 chalcone synthase; Provisional Back     alignment and domain information
>PLN03172 chalcone synthase family protein; Provisional Back     alignment and domain information
>PLN03173 chalcone synthase; Provisional Back     alignment and domain information
>PRK07855 lipid-transfer protein; Provisional Back     alignment and domain information
>PLN02192 3-ketoacyl-CoA synthase Back     alignment and domain information
>cd00825 decarbox_cond_enzymes decarboxylating condensing enzymes; Family of enzymes that catalyze the formation of a new carbon-carbon bond by a decarboxylating Claisen-like condensation reaction Back     alignment and domain information
>KOG1406|consensus Back     alignment and domain information
>TIGR01835 HMG-CoA-S_prok 3-hydroxy-3-methylglutaryl CoA synthase, prokaryotic clade Back     alignment and domain information
>PRK06066 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>TIGR01833 HMG-CoA-S_euk 3-hydroxy-3-methylglutaryl-CoA-synthase, eukaryotic clade Back     alignment and domain information
>COG0183 PaaJ Acetyl-CoA acetyltransferase [Lipid metabolism] Back     alignment and domain information
>PLN02854 3-ketoacyl-CoA synthase Back     alignment and domain information
>PRK08257 acetyl-CoA acetyltransferase; Validated Back     alignment and domain information
>smart00825 PKS_KS Beta-ketoacyl synthase Back     alignment and domain information
>PLN00415 3-ketoacyl-CoA synthase Back     alignment and domain information
>cd00834 KAS_I_II Beta-ketoacyl-acyl carrier protein (ACP) synthase (KAS), type I and II Back     alignment and domain information
>KOG1390|consensus Back     alignment and domain information
>KOG1391|consensus Back     alignment and domain information
>PRK07314 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>cd00828 elong_cond_enzymes "elongating" condensing enzymes are a subclass of decarboxylating condensing enzymes, including beta-ketoacyl [ACP] synthase, type I and II and polyketide synthases Back     alignment and domain information
>PF08392 FAE1_CUT1_RppA: FAE1/Type III polyketide synthase-like protein; InterPro: IPR013601 This domain is found in proteins that are described as 3-ketoacyl-CoA synthases, type III polyketide synthases, fatty acid elongases and fatty acid condensing enzymes, and are found in both prokaryotic and eukaryotic (mainly plant) species Back     alignment and domain information
>PTZ00050 3-oxoacyl-acyl carrier protein synthase; Provisional Back     alignment and domain information
>TIGR03150 fabF beta-ketoacyl-acyl-carrier-protein synthase II Back     alignment and domain information
>cd00833 PKS polyketide synthases (PKSs) polymerize simple fatty acids into a large variety of different products, called polyketides, by successive decarboxylating Claisen condensations Back     alignment and domain information
>PRK06333 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>PF00195 Chal_sti_synt_N: Chalcone and stilbene synthases, N-terminal domain; InterPro: IPR001099 Synonym(s): Chalcone synthase, Flavonone synthase, 6'-deoxychalcone synthase Naringenin-chalcone synthases (2 Back     alignment and domain information
>PRK07937 lipid-transfer protein; Provisional Back     alignment and domain information
>PRK08439 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>PF00109 ketoacyl-synt: Beta-ketoacyl synthase, N-terminal domain; InterPro: IPR014030 Beta-ketoacyl-ACP synthase 2 Back     alignment and domain information
>PRK08722 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>PLN02836 3-oxoacyl-[acyl-carrier-protein] synthase Back     alignment and domain information
>PRK07967 3-oxoacyl-(acyl carrier protein) synthase I; Reviewed Back     alignment and domain information
>PRK06147 3-oxoacyl-(acyl carrier protein) synthase; Validated Back     alignment and domain information
>PRK06519 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>COG3425 PksG 3-hydroxy-3-methylglutaryl CoA synthase [Lipid metabolism] Back     alignment and domain information
>PRK14691 3-oxoacyl-(acyl carrier protein) synthase II; Provisional Back     alignment and domain information
>PLN02787 3-oxoacyl-[acyl-carrier-protein] synthase II Back     alignment and domain information
>PRK09116 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>PRK07103 polyketide beta-ketoacyl:acyl carrier protein synthase; Validated Back     alignment and domain information
>PF01154 HMG_CoA_synt_N: Hydroxymethylglutaryl-coenzyme A synthase N terminal; InterPro: IPR013528 Synonym(s): 3-hydroxy-3-methylglutaryl-coenzyme A synthase, HMG-CoA synthase Back     alignment and domain information
>cd00832 CLF Chain-length factor (CLF) is a factor required for polyketide chain initiation of aromatic antibiotic-producing polyketide synthases (PKSs) of filamentous bacteria Back     alignment and domain information
>PRK06501 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>COG3321 Polyketide synthase modules and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK07910 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>PRK05952 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>COG3424 BcsA Predicted naringenin-chalcone synthase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG0304 FabB 3-oxoacyl-(acyl-carrier-protein) synthase [Lipid metabolism / Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>KOG1389|consensus Back     alignment and domain information
>KOG1392|consensus Back     alignment and domain information
>TIGR02813 omega_3_PfaA polyketide-type polyunsaturated fatty acid synthase PfaA Back     alignment and domain information
>KOG1394|consensus Back     alignment and domain information
>PF07451 SpoVAD: Stage V sporulation protein AD (SpoVAD); InterPro: IPR010894 This family contains the bacterial stage V sporulation protein AD (SpoVAD), which is approximately 340 residues long Back     alignment and domain information
>PRK09185 3-oxoacyl-(acyl carrier protein) synthase I; Reviewed Back     alignment and domain information
>PF08545 ACP_syn_III: 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III; InterPro: IPR013751 Fatty acid synthesis (FAS) is a vital aspect of cellular physiology which can occur by two distinct pathways Back     alignment and domain information
>KOG1202|consensus Back     alignment and domain information
>PF13723 Ketoacyl-synt_2: Beta-ketoacyl synthase, N-terminal domain Back     alignment and domain information
>KOG1393|consensus Back     alignment and domain information
>PF08541 ACP_syn_III_C: 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C terminal ; InterPro: IPR013747 This domain is found on 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III 2 Back     alignment and domain information
>PRK06147 3-oxoacyl-(acyl carrier protein) synthase; Validated Back     alignment and domain information
>TIGR00748 HMG_CoA_syn_Arc hydroxymethylglutaryl-CoA synthase, putative Back     alignment and domain information
>PF02801 Ketoacyl-synt_C: Beta-ketoacyl synthase, C-terminal domain; InterPro: IPR014031 Beta-ketoacyl-ACP synthase 2 Back     alignment and domain information
>PRK06816 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>PRK08257 acetyl-CoA acetyltransferase; Validated Back     alignment and domain information
>cd00832 CLF Chain-length factor (CLF) is a factor required for polyketide chain initiation of aromatic antibiotic-producing polyketide synthases (PKSs) of filamentous bacteria Back     alignment and domain information
>PRK09258 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>PRK07515 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>PRK05963 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>PRK04262 hypothetical protein; Provisional Back     alignment and domain information
>cd00834 KAS_I_II Beta-ketoacyl-acyl carrier protein (ACP) synthase (KAS), type I and II Back     alignment and domain information
>PRK05952 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>PRK07204 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>CHL00203 fabH 3-oxoacyl-acyl-carrier-protein synthase 3; Provisional Back     alignment and domain information
>PRK06025 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06840 hypothetical protein; Validated Back     alignment and domain information
>PRK07910 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>TIGR03150 fabF beta-ketoacyl-acyl-carrier-protein synthase II Back     alignment and domain information
>PRK06519 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>PLN02326 3-oxoacyl-[acyl-carrier-protein] synthase III Back     alignment and domain information
>cd00828 elong_cond_enzymes "elongating" condensing enzymes are a subclass of decarboxylating condensing enzymes, including beta-ketoacyl [ACP] synthase, type I and II and polyketide synthases Back     alignment and domain information
>PRK09185 3-oxoacyl-(acyl carrier protein) synthase I; Reviewed Back     alignment and domain information
>PLN02787 3-oxoacyl-[acyl-carrier-protein] synthase II Back     alignment and domain information
>PRK07314 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>PRK08722 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>PRK12879 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>COG0304 FabB 3-oxoacyl-(acyl-carrier-protein) synthase [Lipid metabolism / Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR00747 fabH 3-oxoacyl-(acyl-carrier-protein) synthase III Back     alignment and domain information
>cd00830 KAS_III Ketoacyl-acyl carrier protein synthase III (KASIII) initiates the elongation in type II fatty acid synthase systems Back     alignment and domain information
>PRK05790 putative acyltransferase; Provisional Back     alignment and domain information
>PTZ00050 3-oxoacyl-acyl carrier protein synthase; Provisional Back     alignment and domain information
>PRK09050 beta-ketoadipyl CoA thiolase; Validated Back     alignment and domain information
>TIGR01930 AcCoA-C-Actrans acetyl-CoA acetyltransferases Back     alignment and domain information
>COG1214 Inactive homolog of metal-dependent proteases, putative molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK07103 polyketide beta-ketoacyl:acyl carrier protein synthase; Validated Back     alignment and domain information
>PLN02287 3-ketoacyl-CoA thiolase Back     alignment and domain information
>PRK09051 beta-ketothiolase; Provisional Back     alignment and domain information
>PRK09052 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK14691 3-oxoacyl-(acyl carrier protein) synthase II; Provisional Back     alignment and domain information
>TIGR01796 CM_mono_aroH monofunctional chorismate mutase, gram positive type, clade 1 Back     alignment and domain information
>PRK13359 beta-ketoadipyl CoA thiolase; Provisional Back     alignment and domain information
>PF02803 Thiolase_C: Thiolase, C-terminal domain; InterPro: IPR020617 Two different types of thiolase [, , ] are found both in eukaryotes and in prokaryotes: acetoacetyl-CoA thiolase (2 Back     alignment and domain information
>PRK06690 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PLN02836 3-oxoacyl-[acyl-carrier-protein] synthase Back     alignment and domain information
>PRK07937 lipid-transfer protein; Provisional Back     alignment and domain information
>PRK06333 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>TIGR03285 methan_mark_14 putative methanogenesis marker protein 14 Back     alignment and domain information
>PF07736 CM_1: Chorismate mutase type I; InterPro: IPR008243 Chorismate mutase (CM; 5 Back     alignment and domain information
>TIGR02430 pcaF beta-ketoadipyl CoA thiolase Back     alignment and domain information
>PRK09116 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>PRK06501 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>cd00833 PKS polyketide synthases (PKSs) polymerize simple fatty acids into a large variety of different products, called polyketides, by successive decarboxylating Claisen condensations Back     alignment and domain information
>PRK09352 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>cd00825 decarbox_cond_enzymes decarboxylating condensing enzymes; Family of enzymes that catalyze the formation of a new carbon-carbon bond by a decarboxylating Claisen-like condensation reaction Back     alignment and domain information
>smart00825 PKS_KS Beta-ketoacyl synthase Back     alignment and domain information
>cd00751 thiolase Thiolase are ubiquitous enzymes that catalyze the reversible thiolytic cleavage of 3-ketoacyl-CoA into acyl-CoA and acetyl-CoA, a 2-step reaction involving a covalent intermediate formed with a catalytic cysteine Back     alignment and domain information
>COG0332 FabH 3-oxoacyl-[acyl-carrier-protein] Back     alignment and domain information
>PF00814 Peptidase_M22: Glycoprotease family; InterPro: IPR000905 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PRK06205 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK07661 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK05656 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>cd00327 cond_enzymes Condensing enzymes; Family of enzymes that catalyze a (decarboxylating or non-decarboxylating) Claisen-like condensation reaction Back     alignment and domain information
>TIGR03725 bact_YeaZ universal bacterial protein YeaZ Back     alignment and domain information
>PRK08242 acetyl-CoA acetyltransferase; Validated Back     alignment and domain information
>KOG1394|consensus Back     alignment and domain information
>PRK07850 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06445 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06366 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06954 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK12880 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>cd02185 AroH Chorismate mutase (AroH) is one of at least five chorismate-utilizing enzymes present in microorganisms that catalyze the rearrangement of chorismate to prephenic acid, the first committed step in the biosynthesis of aromatic amino acids Back     alignment and domain information
>PRK08235 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK07851 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PF09887 DUF2114: Uncharacterized protein conserved in archaea (DUF2114); InterPro: IPR008303 There are currently no experimental data for members of this group or their homologues Back     alignment and domain information
>PRK07801 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06158 thiolase; Provisional Back     alignment and domain information
>PF14574 DUF4445: Domain of unknown function (DUF4445); PDB: 3ZYY_X Back     alignment and domain information
>PLN02644 acetyl-CoA C-acetyltransferase Back     alignment and domain information
>PRK09604 UGMP family protein; Validated Back     alignment and domain information
>TIGR00329 gcp_kae1 metallohydrolase, glycoprotease/Kae1 family Back     alignment and domain information
>PRK06504 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06633 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK08256 lipid-transfer protein; Provisional Back     alignment and domain information
>cd00831 CHS_like Chalcone and stilbene synthases; plant-specific polyketide synthases (PKS) and related enzymes, also called type III PKSs Back     alignment and domain information
>PRK08304 stage V sporulation protein AD; Validated Back     alignment and domain information
>COG3425 PksG 3-hydroxy-3-methylglutaryl CoA synthase [Lipid metabolism] Back     alignment and domain information
>TIGR02845 spore_V_AD stage V sporulation protein AD Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query110
3s3l_A 357 CERJ; acyltransferase, FABH homologue, KS III homo 3e-08
3lma_A 347 Stage V sporulation protein AD (spovad); NESG, str 1e-07
1mzj_A 339 Beta-ketoacylsynthase III; beta-ketosynthase, arom 2e-06
3h78_A 359 PQS biosynthetic enzyme; PQSD, anthranilic acid, a 3e-06
3ss6_A 394 Acetyl-COA acetyltransferase; structural genomics, 3e-06
1hnj_A 317 Beta-ketoacyl-acyl carrier protein synthase III; F 4e-06
4dd5_A 396 Acetyl-COA acetyltransferase; structural genomics, 6e-06
1u6e_A 335 3-oxoacyl-[acyl-carrier-protein] synthase III; tra 7e-06
4e1l_A 395 Acetoacetyl-COA thiolase 2; 3-layer(ABA) sandwich, 8e-06
3il3_A 323 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, 1e-05
2vu1_A 392 Acetyl-COA acetyltransferase; acyltransferase, PHB 2e-05
1afw_A 393 3-ketoacetyl-COA thiolase; fatty acid metabolism; 2e-05
2ebd_A 309 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, 2e-05
2iik_A 418 3-ketoacyl-COA thiolase, peroxisomal; fatty acid m 2e-05
1zow_A 313 3-oxoacyl-[acyl-carrier-protein] synthase III; FAB 3e-05
2wu9_A 442 3-ketoacyl-COA thiolase 2, peroxisomal; cysteine o 5e-05
1wl4_A 397 Acetyl-coenzyme A acetyltransferase 2; thiolase fo 1e-04
3ov2_A 393 Curcumin synthase; type III polyketide synthase, t 2e-04
3s21_A 345 3-oxoacyl-[ACP] synthase III; non-decarboxylative 2e-04
3il6_A 321 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, 3e-04
1u0m_A 382 Putative polyketide synthase; type III polyketide 7e-04
3v7i_A 413 Putative polyketide synthase; type III polyketide 8e-04
2ib8_A 395 Acetyl-COA acetyltransferase; thiolase fold, potas 8e-04
>3s3l_A CERJ; acyltransferase, FABH homologue, KS III homologue, dimethyl transfer, transferase; 2.00A {Streptomyces tendae} PDB: 3t5y_A* 3t6s_A* 3t8e_A 3t5y_B* Length = 357 Back     alignment and structure
 Score = 48.8 bits (117), Expect = 3e-08
 Identities = 16/89 (17%), Positives = 27/89 (30%), Gaps = 10/89 (11%)

Query: 6   EDTDYPELAKEALIKALDDAGISINQVQQACCGYVYGDSTCG-------QRALYQIGMTG 58
           E+   P +A  A   AL    +    V       ++                        
Sbjct: 50  EEDAPPRMAARAARAALGRGDVDPADVSLVLHSSLWFQGIDLWPAASYVAHEA---VGRH 106

Query: 59  IPVFNVNNNCSTGSSALMLAKQFIESGSD 87
           +P F +   C+ G  A+ LA  ++ SG  
Sbjct: 107 VPAFGLAQRCNGGMGAIELAGAYLGSGIG 135


>3lma_A Stage V sporulation protein AD (spovad); NESG, structural genomics, PSI-2, protein structure initiative; 1.99A {Bacillus licheniformis} PDB: 3lm6_A Length = 347 Back     alignment and structure
>1mzj_A Beta-ketoacylsynthase III; beta-ketosynthase, aromatic polyketide, biosynthetic engineering, catalytic triad, transferase; HET: COA; 2.10A {Streptomyces SP} SCOP: c.95.1.2 c.95.1.2 Length = 339 Back     alignment and structure
>3h78_A PQS biosynthetic enzyme; PQSD, anthranilic acid, anthraniloyl-COA, transferase; HET: BE2; 1.70A {Pseudomonas aeruginosa PAO1} PDB: 3h76_A 3h77_A* Length = 359 Back     alignment and structure
>3ss6_A Acetyl-COA acetyltransferase; structural genomics, csgid, center for structural genomics O infectious diseases, alpha beta; HET: CSO; 1.70A {Bacillus anthracis} Length = 394 Back     alignment and structure
>1hnj_A Beta-ketoacyl-acyl carrier protein synthase III; FABH, transferase; HET: MLC; 1.46A {Escherichia coli} SCOP: c.95.1.2 c.95.1.2 PDB: 1hn9_A* 1hnh_A* 1hnd_A* 1hnk_A 1mzs_A* 2eft_A* 2gyo_A* 3il9_A 1ebl_A* Length = 317 Back     alignment and structure
>4dd5_A Acetyl-COA acetyltransferase; structural genomics, center for structural genomics of infec diseases, csgid, thiolase; 1.25A {Clostridium difficile} Length = 396 Back     alignment and structure
>1u6e_A 3-oxoacyl-[acyl-carrier-protein] synthase III; transferase; 1.85A {Mycobacterium tuberculosis} SCOP: c.95.1.2 c.95.1.2 PDB: 1u6s_A* 1m1m_A 1hzp_A* 2qnx_A* 2qnz_A* 2qo1_A* 2qx1_A* 2qo0_A* 2qny_A* 2ahb_A 2aj9_A Length = 335 Back     alignment and structure
>4e1l_A Acetoacetyl-COA thiolase 2; 3-layer(ABA) sandwich, transferase; 2.00A {Clostridium difficile} Length = 395 Back     alignment and structure
>3il3_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, fatty acid biosynthesis, antibiotic, acyltransferase, cytoplasm, lipid synthesis; 2.70A {Haemophilus influenzae} Length = 323 Back     alignment and structure
>2vu1_A Acetyl-COA acetyltransferase; acyltransferase, PHB biosynthesis, thiolase FOL; HET: CSO OPI; 1.51A {Zoogloea ramigera} PDB: 1nl7_A* 1ou6_A* 2vu0_A* 1m4s_A* 2vu2_A* 2wkv_A* 2wku_A* 1m1t_A 1m3k_A 1m1o_A 1m3z_A* 2vtz_A* 2wl5_A* 2wkt_A* 2wl4_A* 1m4t_A* 2wl6_A 1qfl_A* 1dlv_A* 1dlu_A* ... Length = 392 Back     alignment and structure
>1afw_A 3-ketoacetyl-COA thiolase; fatty acid metabolism; 1.80A {Saccharomyces cerevisiae} SCOP: c.95.1.1 c.95.1.1 PDB: 1pxt_A Length = 393 Back     alignment and structure
>2ebd_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, aquifex VF5, lipid metabolism, structural genomics; 2.10A {Aquifex aeolicus} Length = 309 Back     alignment and structure
>2iik_A 3-ketoacyl-COA thiolase, peroxisomal; fatty acid metabolism, structural genomics, structural genom consortium, SGC, transferase; 2.55A {Homo sapiens} Length = 418 Back     alignment and structure
>1zow_A 3-oxoacyl-[acyl-carrier-protein] synthase III; FABH, fatty acid biosynthesis, transferase; 2.00A {Staphylococcus aureus subsp} PDB: 3il7_A Length = 313 Back     alignment and structure
>2wu9_A 3-ketoacyl-COA thiolase 2, peroxisomal; cysteine oxidation, fatty acid metabolism, oxylipin biosynthesis, plant lipid metabolism; 1.50A {Arabidopsis thaliana} PDB: 2c7y_A 2c7z_A 2wua_A Length = 442 Back     alignment and structure
>1wl4_A Acetyl-coenzyme A acetyltransferase 2; thiolase fold; HET: COA; 1.55A {Homo sapiens} PDB: 1wl5_A Length = 397 Back     alignment and structure
>3ov2_A Curcumin synthase; type III polyketide synthase, transferase; 2.32A {Curcuma longa} PDB: 3ov3_A Length = 393 Back     alignment and structure
>3s21_A 3-oxoacyl-[ACP] synthase III; non-decarboxylative claisen condensation reaction, transfera; HET: CER; 1.70A {Xanthomonas campestris PV} PDB: 3s23_A* 3row_A 3s1z_A 3s20_A* 3fk5_A Length = 345 Back     alignment and structure
>3il6_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, fatty acid biosynthesis, antibiotic, acyltransferase, cytoplasm, lipid synthesis; HET: B83; 2.50A {Enterococcus faecalis} PDB: 3il5_A* 3il4_A* Length = 321 Back     alignment and structure
>1u0m_A Putative polyketide synthase; type III polyketide synthase, PKS, bacterial, thiolase fold, beta-alpha-beta-alpha fold, catalytic triad; HET: 15P; 2.22A {Streptomyces coelicolor} SCOP: c.95.1.2 c.95.1.2 Length = 382 Back     alignment and structure
>3v7i_A Putative polyketide synthase; type III polyketide synthase, acyltransferase, transferase,; 2.90A {Streptomyces coelicolor} Length = 413 Back     alignment and structure
>2ib8_A Acetyl-COA acetyltransferase; thiolase fold, potassium ION, chloride, beta-alpha-beta-ALPH alpha-beta-BETA topology; HET: MES; 1.85A {Homo sapiens} PDB: 2ib7_A* 2ib9_A* 2ibu_A* 2ibw_A* 2iby_A* 2f2s_A* Length = 395 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query110
4ewp_A 350 3-oxoacyl-[acyl-carrier-protein] synthase 3; trans 99.81
3lma_A 347 Stage V sporulation protein AD (spovad); NESG, str 99.8
3il3_A 323 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, 99.79
4dd5_A 396 Acetyl-COA acetyltransferase; structural genomics, 99.79
3goa_A 387 3-ketoacyl-COA thiolase; metabolism, fatty acid, p 99.79
3ss6_A 394 Acetyl-COA acetyltransferase; structural genomics, 99.79
4e1l_A 395 Acetoacetyl-COA thiolase 2; 3-layer(ABA) sandwich, 99.78
4dfe_A 333 3-oxoacyl-[acyl-carrier-protein] synthase 3; ssgci 99.78
3h78_A 359 PQS biosynthetic enzyme; PQSD, anthranilic acid, a 99.77
3gwa_A 365 3-oxoacyl-(acyl-carrier-protein) synthase III; str 99.77
1ulq_A 401 Putative acetyl-COA acetyltransferase; structural 99.77
4efi_A 354 3-oxoacyl-(acyl-carrier protein) synthase; structu 99.77
3il6_A 321 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, 99.77
2wu9_A 442 3-ketoacyl-COA thiolase 2, peroxisomal; cysteine o 99.76
1zow_A 313 3-oxoacyl-[acyl-carrier-protein] synthase III; FAB 99.76
2iik_A 418 3-ketoacyl-COA thiolase, peroxisomal; fatty acid m 99.76
3svk_A 407 Acetyl-COA acetyltransferase; ssgcid, NIH, niaid, 99.76
3s21_A 345 3-oxoacyl-[ACP] synthase III; non-decarboxylative 99.75
2vu1_A 392 Acetyl-COA acetyltransferase; acyltransferase, PHB 99.75
1u6e_A 335 3-oxoacyl-[acyl-carrier-protein] synthase III; tra 99.75
1mzj_A 339 Beta-ketoacylsynthase III; beta-ketosynthase, arom 99.75
1wl4_A 397 Acetyl-coenzyme A acetyltransferase 2; thiolase fo 99.75
1hnj_A 317 Beta-ketoacyl-acyl carrier protein synthase III; F 99.75
1afw_A 393 3-ketoacetyl-COA thiolase; fatty acid metabolism; 99.75
3s3l_A 357 CERJ; acyltransferase, FABH homologue, KS III homo 99.75
2ebd_A 309 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, 99.74
3led_A 392 3-oxoacyl-acyl carrier protein synthase III; struc 99.74
1wdk_C 390 3-ketoacyl-COA thiolase; alpha2BETA2 heterotetrame 99.74
2ib8_A 395 Acetyl-COA acetyltransferase; thiolase fold, potas 99.73
1ub7_A 322 3-oxoacyl-[acyl-carrier protein] synthase; fatty a 99.73
3oit_A 387 OS07G0271500 protein; type III polyketide synthase 99.7
2v4w_A 460 Hydroxymethylglutaryl-COA synthase, mitochondrial; 99.7
3ov2_A 393 Curcumin synthase; type III polyketide synthase, t 99.7
2h84_A 374 Steely1; thiolase-fold, type III polyketide syntha 99.7
3v7i_A 413 Putative polyketide synthase; type III polyketide 99.69
1i88_A 389 CHS2, chalcone synthase 2; polyketide synthase, tr 99.68
2x3e_A 331 3-oxoacyl-[acyl-carrier-protein] synthase 3; HED, 99.68
3a5r_A 387 Benzalacetone synthase; chalcone synthase, type II 99.68
3awk_A 402 Chalcone synthase-like polyketide synthase; type I 99.68
2p0u_A 413 Stilbenecarboxylate synthase 2; polyketide synthas 99.68
3euo_A 379 Type III pentaketide synthase; alpha helix, acyltr 99.68
1u0m_A 382 Putative polyketide synthase; type III polyketide 99.67
2d3m_A 406 Pentaketide chromone synthase; chalcone synthase, 99.67
3mqd_A 428 Beta-ketoacyl synthase; ssgcid, ALS collaborative 99.66
1xes_A 413 Dihydropinosylvin synthase; native structure, tran 99.66
1ee0_A 402 2-pyrone synthase; polyketide synthase, thiolase f 99.66
2f82_A 450 HMG-COA synthase; HMGS1, transferase; 2.10A {Brass 99.66
3e1h_A 465 PKSIIINC, putative uncharacterized protein; resorc 99.66
1ted_A 393 PKS18; thiolase fold, substrate binding tunnel, tr 99.65
4egv_A 520 Acetyl-COA acetyltransferase; NEW SUB-family, thio 99.65
3v4n_A 388 HMG-COA synthase; hydroxymethylglutaryl-COA syntha 99.63
2gqd_A 437 3-oxoacyl-[acyl-carrier-protein] synthase 2; dupli 99.63
3sqz_A 425 Putative hydroxymethylglutaryl-COA synthase; thiol 99.62
4ewg_A 412 Beta-ketoacyl synthase; ssgcid, structural genomic 99.62
3o04_A 413 LMO2201 protein, beta-keto-acyl carrier protein sy 99.62
1e5m_A 416 KAS II, beta ketoacyl acyl carrier protein synthas 99.61
3tsy_A 979 Fusion protein 4-coumarate--COA ligase 1, resvera 99.61
1ox0_A 430 Beta ketoacyl-acyl carrier protein synthase; trans 99.61
2vba_A 406 3-oxoacyl-[acyl-carrier-protein] synthase 1; cytop 99.6
1tqy_A 424 Beta-ketoacyl synthase/acyl transferase; alpha-bet 99.6
2ix4_A 431 3-oxoacyl-[acyl-carrier-protein] synthase; beta-ke 99.6
1j3n_A 408 3-oxoacyl-(acyl-carrier protein) synthase II; cond 99.6
3ho9_A 427 3-oxoacyl-[acyl-carrier-protein] synthase 2; FABF, 99.6
2iwz_A 438 3-oxoacyl-[acyl-carrier-protein] synthase; mitocho 99.59
4ddo_A 451 3-oxoacyl-[acyl-carrier-protein] synthase 2; ssgci 99.58
2p8u_A 478 Hydroxymethylglutaryl-COA synthase, cytoplasmic; h 99.56
3hhd_A 965 Fatty acid synthase; transferase, multienzyme, meg 99.56
1tqy_B 415 Actinorhodin polyketide putative beta-ketoacyl SY; 99.56
2qo3_A 915 Eryaii erythromycin polyketide synthase modules 3; 99.55
2gp6_A 434 3-oxoacyl-[acyl-carrier-protein] synthase 2; thiol 99.55
3kzu_A 428 3-oxoacyl-(acyl-carrier-protein) synthase II; seat 99.55
2wge_A 416 3-oxoacyl-[acyl-carrier-protein] synthase 1; beta 99.54
1xpm_A 396 3-hydroxy-3-methylglutaryl COA synthase; HMG-COA s 99.54
2hg4_A 917 DEBS, 6-deoxyerythronolide B synthase; ketosynthas 99.54
2wya_A 460 Hydroxymethylglutaryl-COA synthase, mitochondrial; 99.51
2vz8_A 2512 Fatty acid synthase; transferase, phosphopantethei 99.29
3zen_D 3089 Fatty acid synthase; transferase, mycolic acid bio 99.24
2pff_A 1688 Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl 99.13
2uv8_A 1887 Fatty acid synthase subunit alpha (FAS2); fatty ac 99.13
2uv9_A 1878 Fatty acid synthase alpha subunits; fungal, dehydr 99.1
3lma_A347 Stage V sporulation protein AD (spovad); NESG, str 95.98
1hnj_A317 Beta-ketoacyl-acyl carrier protein synthase III; F 95.77
1zow_A313 3-oxoacyl-[acyl-carrier-protein] synthase III; FAB 95.65
1mzj_A339 Beta-ketoacylsynthase III; beta-ketosynthase, arom 95.59
2ebd_A309 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, 95.45
1ub7_A322 3-oxoacyl-[acyl-carrier protein] synthase; fatty a 95.45
2x3e_A331 3-oxoacyl-[acyl-carrier-protein] synthase 3; HED, 95.39
1u6e_A335 3-oxoacyl-[acyl-carrier-protein] synthase III; tra 95.33
3h78_A359 PQS biosynthetic enzyme; PQSD, anthranilic acid, a 95.22
4dfe_A333 3-oxoacyl-[acyl-carrier-protein] synthase 3; ssgci 94.78
1ulq_A401 Putative acetyl-COA acetyltransferase; structural 94.67
3s21_A345 3-oxoacyl-[ACP] synthase III; non-decarboxylative 94.62
4e1l_A395 Acetoacetyl-COA thiolase 2; 3-layer(ABA) sandwich, 94.29
3gwa_A365 3-oxoacyl-(acyl-carrier-protein) synthase III; str 94.26
4efi_A354 3-oxoacyl-(acyl-carrier protein) synthase; structu 94.16
1wl4_A397 Acetyl-coenzyme A acetyltransferase 2; thiolase fo 94.13
2vu1_A392 Acetyl-COA acetyltransferase; acyltransferase, PHB 94.11
3ss6_A394 Acetyl-COA acetyltransferase; structural genomics, 93.88
3il3_A323 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, 93.68
4dd5_A396 Acetyl-COA acetyltransferase; structural genomics, 93.55
1ted_A393 PKS18; thiolase fold, substrate binding tunnel, tr 93.48
4ewp_A350 3-oxoacyl-[acyl-carrier-protein] synthase 3; trans 93.3
2ib8_A395 Acetyl-COA acetyltransferase; thiolase fold, potas 93.23
1xho_A148 Chorismate mutase; southeast collaboratory for str 93.07
3tsy_A979 Fusion protein 4-coumarate--COA ligase 1, resvera 92.71
3svk_A407 Acetyl-COA acetyltransferase; ssgcid, NIH, niaid, 92.59
3s3l_A357 CERJ; acyltransferase, FABH homologue, KS III homo 92.57
3led_A392 3-oxoacyl-acyl carrier protein synthase III; struc 92.46
4egv_A520 Acetyl-COA acetyltransferase; NEW SUB-family, thio 91.89
3r6m_A213 YEAZ, resuscitation promoting factor; actin/HSP70 91.32
1tqy_B415 Actinorhodin polyketide putative beta-ketoacyl SY; 91.2
2iik_A418 3-ketoacyl-COA thiolase, peroxisomal; fatty acid m 90.96
1dbf_A127 Protein (chorismate mutase); shikimate pathway, is 90.72
3ho9_A427 3-oxoacyl-[acyl-carrier-protein] synthase 2; FABF, 90.7
1u0m_A382 Putative polyketide synthase; type III polyketide 90.58
2gel_A231 Putative GRAM negative resuscitation promoting FA; 90.46
3kzu_A428 3-oxoacyl-(acyl-carrier-protein) synthase II; seat 90.42
1ufy_A122 Chorismate mutase; shikimate pathway, mutant, rike 90.35
1wdk_C390 3-ketoacyl-COA thiolase; alpha2BETA2 heterotetrame 90.26
1j3n_A408 3-oxoacyl-(acyl-carrier protein) synthase II; cond 89.89
2a6a_A218 Hypothetical protein TM0874; glycoprotein endopept 89.71
4ewg_A412 Beta-ketoacyl synthase; ssgcid, structural genomic 89.34
3o04_A413 LMO2201 protein, beta-keto-acyl carrier protein sy 89.32
3goa_A387 3-ketoacyl-COA thiolase; metabolism, fatty acid, p 89.3
4ddo_A451 3-oxoacyl-[acyl-carrier-protein] synthase 2; ssgci 88.89
1tqy_A424 Beta-ketoacyl synthase/acyl transferase; alpha-bet 88.89
1ox0_A430 Beta ketoacyl-acyl carrier protein synthase; trans 87.96
2wge_A416 3-oxoacyl-[acyl-carrier-protein] synthase 1; beta 87.18
2gp6_A434 3-oxoacyl-[acyl-carrier-protein] synthase 2; thiol 86.27
2h84_A374 Steely1; thiolase-fold, type III polyketide syntha 84.8
2qo3_A 915 Eryaii erythromycin polyketide synthase modules 3; 84.27
2d3m_A406 Pentaketide chromone synthase; chalcone synthase, 83.92
1afw_A393 3-ketoacetyl-COA thiolase; fatty acid metabolism; 82.96
3eno_A 334 Putative O-sialoglycoprotein endopeptidase; hydrol 82.08
2ivn_A 330 O-sialoglycoprotein endopeptidase; UP1 keops compl 81.84
3ven_A 576 O-carbamoyltransferase TOBZ; antibiotic biosynthes 81.01
2wu9_A442 3-ketoacyl-COA thiolase 2, peroxisomal; cysteine o 80.43
1e5m_A416 KAS II, beta ketoacyl acyl carrier protein synthas 80.11
3hhd_A 965 Fatty acid synthase; transferase, multienzyme, meg 80.07
2gqd_A437 3-oxoacyl-[acyl-carrier-protein] synthase 2; dupli 80.02
>4ewp_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; transferase; 2.20A {Micrococcus luteus nctc 2665} Back     alignment and structure
Probab=99.81  E-value=4.5e-19  Score=126.03  Aligned_cols=96  Identities=21%  Similarity=0.303  Sum_probs=88.0

Q ss_pred             CCCCHHHHHHHHHHHHHHHcCCCccccCeEEEEeecCCCcch---hHHHHHcCCCCCCeeeEeccchHHHHHHHHHHHHH
Q psy13271          6 EDTDYPELAKEALIKALDDAGISINQVQQACCGYVYGDSTCG---QRALYQIGMTGIPVFNVNNNCSTGSSALMLAKQFI   82 (110)
Q Consensus         6 ~~~~~~~l~~~a~~~al~~agl~~~~id~vi~~~~~~~~~~~---~~~a~~lg~~~~~~~~i~~~C~sg~~al~~A~~~i   82 (110)
                      ++++..+|+.+|++++|+++|++++|||.||++++++++..|   ..+++.||+++.++|+++++|++++.||..|..+|
T Consensus        58 ~~e~~~~la~~Aa~~aL~~ag~~~~dId~li~~t~t~~~~~P~~a~~v~~~LGl~~~~a~di~~~C~g~~~aL~~A~~~i  137 (350)
T 4ewp_A           58 AEETVPVMAVGAAREALERAGLQGSDLDAVIVSTVTFPHATPSAAALVAHEIGATPAPAYDVSAACAGYCYGVAQADALV  137 (350)
T ss_dssp             SSCCHHHHHHHHHHHHHHHTTCCGGGCSEEEEECSCCSCSSSCHHHHHHHHTTCTTSCEEEEECGGGHHHHHHHHHHHHH
T ss_pred             CCCCHHHHHHHHHHHHHHHcCCCHHHCCEEEEEeccCCCCCCchHHHHHHHhCCCCceEEEeecchhhHHHHHHHhhhhh
Confidence            578999999999999999999999999999999988876544   35778999988899999999999999999999999


Q ss_pred             HcC-CCeEEEEeeccCCCCC
Q psy13271         83 ESG-SDCTLALGFEKMEKGS  101 (110)
Q Consensus        83 ~sG-~~~vlv~g~e~~s~~~  101 (110)
                      ++| .+++||+++|.+|+..
T Consensus       138 ~~g~~~~~Lvv~~E~~s~~~  157 (350)
T 4ewp_A          138 RSGTARHVLVVGVERLSDVV  157 (350)
T ss_dssp             HTTSCSEEEEEEEEEGGGGC
T ss_pred             hCCCccceeEeeeeeceecc
Confidence            999 9999999999988654



>3lma_A Stage V sporulation protein AD (spovad); NESG, structural genomics, PSI-2, protein structure initiative; 1.99A {Bacillus licheniformis} PDB: 3lm6_A Back     alignment and structure
>3il3_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, fatty acid biosynthesis, antibiotic, acyltransferase, cytoplasm, lipid synthesis; 2.70A {Haemophilus influenzae} Back     alignment and structure
>4dd5_A Acetyl-COA acetyltransferase; structural genomics, center for structural genomics of infec diseases, csgid, thiolase; 1.25A {Clostridium difficile} Back     alignment and structure
>3goa_A 3-ketoacyl-COA thiolase; metabolism, fatty acid, phospholipid, IDP01071, acyltransferase, cytoplasm, fatty acid metabolism; 1.70A {Salmonella typhimurium} Back     alignment and structure
>3ss6_A Acetyl-COA acetyltransferase; structural genomics, csgid, center for structural genomics O infectious diseases, alpha beta; HET: CSO; 1.70A {Bacillus anthracis} Back     alignment and structure
>4e1l_A Acetoacetyl-COA thiolase 2; 3-layer(ABA) sandwich, transferase; 2.00A {Clostridium difficile} Back     alignment and structure
>4dfe_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; ssgcid, seattle structural genomics center for infectious DI transferase; 2.35A {Burkholderia xenovorans} Back     alignment and structure
>3h78_A PQS biosynthetic enzyme; PQSD, anthranilic acid, anthraniloyl-COA, transferase; HET: BE2; 1.70A {Pseudomonas aeruginosa PAO1} PDB: 3h76_A 3h77_A* Back     alignment and structure
>3gwa_A 3-oxoacyl-(acyl-carrier-protein) synthase III; structural genomics, synthetase; 1.60A {Burkholderia pseudomallei} PDB: 3gwe_A Back     alignment and structure
>1ulq_A Putative acetyl-COA acetyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 3.00A {Thermus thermophilus} SCOP: c.95.1.1 c.95.1.1 Back     alignment and structure
>4efi_A 3-oxoacyl-(acyl-carrier protein) synthase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.35A {Burkholderia xenovorans} Back     alignment and structure
>3il6_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, fatty acid biosynthesis, antibiotic, acyltransferase, cytoplasm, lipid synthesis; HET: B83; 2.50A {Enterococcus faecalis} PDB: 3il5_A* 3il4_A* Back     alignment and structure
>2wu9_A 3-ketoacyl-COA thiolase 2, peroxisomal; cysteine oxidation, fatty acid metabolism, oxylipin biosynthesis, plant lipid metabolism; 1.50A {Arabidopsis thaliana} PDB: 2c7y_A 2c7z_A 2wua_A Back     alignment and structure
>1zow_A 3-oxoacyl-[acyl-carrier-protein] synthase III; FABH, fatty acid biosynthesis, transferase; 2.00A {Staphylococcus aureus subsp} PDB: 3il7_A Back     alignment and structure
>2iik_A 3-ketoacyl-COA thiolase, peroxisomal; fatty acid metabolism, structural genomics, structural genom consortium, SGC, transferase; 2.55A {Homo sapiens} Back     alignment and structure
>3svk_A Acetyl-COA acetyltransferase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.20A {Mycobacterium avium} Back     alignment and structure
>3s21_A 3-oxoacyl-[ACP] synthase III; non-decarboxylative claisen condensation reaction, transfera; HET: CER; 1.70A {Xanthomonas campestris PV} PDB: 3s23_A* 3row_A 3s1z_A 3s20_A* 3fk5_A Back     alignment and structure
>2vu1_A Acetyl-COA acetyltransferase; acyltransferase, PHB biosynthesis, thiolase FOL; HET: CSO OPI; 1.51A {Zoogloea ramigera} PDB: 1nl7_A* 1ou6_A* 2vu0_A* 1m4s_A* 2vu2_A* 2wkv_A* 2wku_A* 1m1t_A 1m3k_A 1m1o_A 1m3z_A* 2vtz_A* 2wl5_A* 2wkt_A* 2wl4_A* 1m4t_A* 2wl6_A 1qfl_A* 1dlv_A* 1dlu_A* ... Back     alignment and structure
>1u6e_A 3-oxoacyl-[acyl-carrier-protein] synthase III; transferase; 1.85A {Mycobacterium tuberculosis} SCOP: c.95.1.2 c.95.1.2 PDB: 1u6s_A* 1m1m_A 1hzp_A* 2qnx_A* 2qnz_A* 2qo1_A* 2qx1_A* 2qo0_A* 2qny_A* 2ahb_A 2aj9_A Back     alignment and structure
>1mzj_A Beta-ketoacylsynthase III; beta-ketosynthase, aromatic polyketide, biosynthetic engineering, catalytic triad, transferase; HET: COA; 2.10A {Streptomyces SP} SCOP: c.95.1.2 c.95.1.2 Back     alignment and structure
>1wl4_A Acetyl-coenzyme A acetyltransferase 2; thiolase fold; HET: COA; 1.55A {Homo sapiens} PDB: 1wl5_A Back     alignment and structure
>1hnj_A Beta-ketoacyl-acyl carrier protein synthase III; FABH, transferase; HET: MLC; 1.46A {Escherichia coli} SCOP: c.95.1.2 c.95.1.2 PDB: 1hn9_A* 1hnh_A* 1hnd_A* 1hnk_A 1mzs_A* 2eft_A* 2gyo_A* 3il9_A 1ebl_A* Back     alignment and structure
>1afw_A 3-ketoacetyl-COA thiolase; fatty acid metabolism; 1.80A {Saccharomyces cerevisiae} SCOP: c.95.1.1 c.95.1.1 PDB: 1pxt_A Back     alignment and structure
>3s3l_A CERJ; acyltransferase, FABH homologue, KS III homologue, dimethyl transfer, transferase; 2.00A {Streptomyces tendae} PDB: 3t5y_A* 3t6s_A* 3t8e_A 3t5y_B* Back     alignment and structure
>2ebd_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, aquifex VF5, lipid metabolism, structural genomics; 2.10A {Aquifex aeolicus} Back     alignment and structure
>3led_A 3-oxoacyl-acyl carrier protein synthase III; structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.45A {Rhodopseudomonas palustris} Back     alignment and structure
>1wdk_C 3-ketoacyl-COA thiolase; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: c.95.1.1 c.95.1.1 PDB: 1wdl_C* 1wdm_C* 2d3t_C* Back     alignment and structure
>2ib8_A Acetyl-COA acetyltransferase; thiolase fold, potassium ION, chloride, beta-alpha-beta-ALPH alpha-beta-BETA topology; HET: MES; 1.85A {Homo sapiens} PDB: 2ib7_A* 2ib9_A* 2ibu_A* 2ibw_A* 2iby_A* 2f2s_A* Back     alignment and structure
>1ub7_A 3-oxoacyl-[acyl-carrier protein] synthase; fatty acid synthesis, beta-ketoacyl-ACP synthase III, FABH; 2.30A {Thermus thermophilus} SCOP: c.95.1.2 c.95.1.2 Back     alignment and structure
>3oit_A OS07G0271500 protein; type III polyketide synthases, transferase; 2.00A {Oryza sativa} PDB: 3ale_A Back     alignment and structure
>3ov2_A Curcumin synthase; type III polyketide synthase, transferase; 2.32A {Curcuma longa} PDB: 3ov3_A Back     alignment and structure
>2h84_A Steely1; thiolase-fold, type III polyketide synthase, PKS, chalcone-S synthase superfamily, type I PKS; HET: P6G; 2.90A {Dictyostelium discoideum} Back     alignment and structure
>3v7i_A Putative polyketide synthase; type III polyketide synthase, acyltransferase, transferase,; 2.90A {Streptomyces coelicolor} Back     alignment and structure
>2x3e_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; HED, transferase, acyltransferase, lipid synthesis, multifun enzyme; 1.81A {Pseudomonas aeruginosa} Back     alignment and structure
>3a5r_A Benzalacetone synthase; chalcone synthase, type III polyketide synthase, transferase, acyltransferase; HET: HC4; 1.60A {Rheum palmatum} PDB: 3a5q_A* 3a5s_A Back     alignment and structure
>1u0m_A Putative polyketide synthase; type III polyketide synthase, PKS, bacterial, thiolase fold, beta-alpha-beta-alpha fold, catalytic triad; HET: 15P; 2.22A {Streptomyces coelicolor} SCOP: c.95.1.2 c.95.1.2 Back     alignment and structure
>3mqd_A Beta-ketoacyl synthase; ssgcid, ALS collaborative crystallography, beta-ketoacyl SYN brucella melitensis, fragments of LIFE; HET: 3MQ; 1.25A {Brucella melitensis biovar abortus} PDB: 3lrf_A* 3u0e_A* 3u0f_A* Back     alignment and structure
>1xes_A Dihydropinosylvin synthase; native structure, transferase; HET: 3IO; 1.70A {Pinus sylvestris} PDB: 1xet_A* 1u0u_A Back     alignment and structure
>2f82_A HMG-COA synthase; HMGS1, transferase; 2.10A {Brassica juncea} PDB: 2f9a_A* 2fa0_A* 2fa3_A* Back     alignment and structure
>3e1h_A PKSIIINC, putative uncharacterized protein; resorcinolic lipid synthase, type III PKS, acyltransferase, transferase; 2.58A {Neurospora crassa} Back     alignment and structure
>1ted_A PKS18; thiolase fold, substrate binding tunnel, transferase; HET: MYR; 2.25A {Mycobacterium tuberculosis} SCOP: c.95.1.2 PDB: 1tee_A Back     alignment and structure
>4egv_A Acetyl-COA acetyltransferase; NEW SUB-family, thiolase fold; 2.71A {Mycobacterium smegmatis} Back     alignment and structure
>3v4n_A HMG-COA synthase; hydroxymethylglutaryl-COA synthase, nitrosylation, transfera inhibitor complex; HET: BTB; 1.60A {Enterococcus faecalis} PDB: 3v4x_A* 1x9e_A 1ysl_B* 1ysl_A* 2hdb_A* Back     alignment and structure
>2gqd_A 3-oxoacyl-[acyl-carrier-protein] synthase 2; duplicated babababb fold, transferase; 2.30A {Staphylococcus aureus} Back     alignment and structure
>4ewg_A Beta-ketoacyl synthase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, transferase; 2.25A {Burkholderia phymatum} Back     alignment and structure
>3o04_A LMO2201 protein, beta-keto-acyl carrier protein synthase II; csgid, structural genomics; 1.85A {Listeria monocytogenes} Back     alignment and structure
>1e5m_A KAS II, beta ketoacyl acyl carrier protein synthase II; condensing enzyme, biosynthetic role, carbon-carbon bond formation; 1.54A {Synechocystis SP} SCOP: c.95.1.1 c.95.1.1 Back     alignment and structure
>3tsy_A Fusion protein 4-coumarate--COA ligase 1, resvera synthase; transferase; 3.10A {Arabidospis thaliana} Back     alignment and structure
>1ox0_A Beta ketoacyl-acyl carrier protein synthase; transferase; 1.30A {Streptococcus pneumoniae} SCOP: c.95.1.1 c.95.1.1 PDB: 1oxh_A 2alm_A 2rjt_A Back     alignment and structure
>2vba_A 3-oxoacyl-[acyl-carrier-protein] synthase 1; cytoplasm, antibiotic, transferase, amino-thiazole, acyltransferase, lipid synthesis; HET: P4T; 1.36A {Escherichia coli} SCOP: c.95.1.1 c.95.1.1 PDB: 1fj4_A* 1g5x_A 2aq7_A* 1fj8_A* 2aqb_A 2bui_A 2buh_A 2vb7_A* 2vb8_A 2vb9_A* 1h4f_A 1dd8_A 2cdh_A 2bz4_A 2byz_A 2bz3_A* 2byy_A* 1f91_A* 2cf2_A 2byw_A ... Back     alignment and structure
>1tqy_A Beta-ketoacyl synthase/acyl transferase; alpha-beta-alpha-beta-alpha, heterodimer, transferase; 2.00A {Streptomyces coelicolor} SCOP: c.95.1.1 c.95.1.1 Back     alignment and structure
>2ix4_A 3-oxoacyl-[acyl-carrier-protein] synthase; beta-ketoacyl-(acyl carrier protein) synthase, lipid metabol condensing enzyme; 1.95A {Arabidopsis thaliana} SCOP: c.95.1.1 c.95.1.1 PDB: 1w0i_A Back     alignment and structure
>1j3n_A 3-oxoacyl-(acyl-carrier protein) synthase II; condensing enzymes, fatty acid elongation, acyl-carrier protein (ACP); HET: CIT; 2.00A {Thermus thermophilus} SCOP: c.95.1.1 c.95.1.1 Back     alignment and structure
>3ho9_A 3-oxoacyl-[acyl-carrier-protein] synthase 2; FABF, platensimycin, platencin A1, KAS2, acyltransferase, fatty acid biosynthesis; HET: N3A; 1.90A {Escherichia coli} PDB: 3hnz_A* 3ho2_A* 3i8p_A* 3g11_A* 2gfx_A* 3g0y_A* 2gfv_A* 2gfw_A 2gfy_A* 1kas_A 1b3n_A Back     alignment and structure
>2iwz_A 3-oxoacyl-[acyl-carrier-protein] synthase; mitochondria, mitochondrion, lipid synthesis, fatty acid SYN fatty acid biosynthesis; 1.65A {Homo sapiens} PDB: 2iwy_A 2c9h_A Back     alignment and structure
>4ddo_A 3-oxoacyl-[acyl-carrier-protein] synthase 2; ssgcid, struct genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia vietnamiensis} PDB: 4f32_A* Back     alignment and structure
>2p8u_A Hydroxymethylglutaryl-COA synthase, cytoplasmic; hydromethylglutaryl COA, mevalonate pathway, structural GENO structural genomics consortium, SGC; HET: COA; 2.00A {Homo sapiens} Back     alignment and structure
>3hhd_A Fatty acid synthase; transferase, multienzyme, megasynthase, fatty acid synthesis, acetylation, cytoplasm, fatty acid biosynthesis, hydrolase; 2.15A {Homo sapiens} PDB: 2jfk_A* 2jfd_A Back     alignment and structure
>1tqy_B Actinorhodin polyketide putative beta-ketoacyl SY; alpha-beta-alpha-beta-alpha, heterodimer, transferase; 2.00A {Streptomyces coelicolor} SCOP: c.95.1.1 c.95.1.1 Back     alignment and structure
>2qo3_A Eryaii erythromycin polyketide synthase modules 3; ketosynthase, acyltransferase, phosphopantetheine, transfera; 2.59A {Saccharopolyspora erythraea} Back     alignment and structure
>2gp6_A 3-oxoacyl-[acyl-carrier-protein] synthase 2; thiolase fold, structural genomics, PSI, protein structure initiative; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3kzu_A 3-oxoacyl-(acyl-carrier-protein) synthase II; seattle structural genomics center for infectious disease, ssgcid, acyltransferase; 1.75A {Brucella melitensis} PDB: 3e60_A Back     alignment and structure
>2wge_A 3-oxoacyl-[acyl-carrier-protein] synthase 1; beta ketoacyl synthase I thiolactomycin, cytoplasm, transferase, acyltransferase; HET: TLM; 1.80A {Mycobacterium tuberculosis} PDB: 2wgd_A* 2wgg_A* 2wgf_A* Back     alignment and structure
>1xpm_A 3-hydroxy-3-methylglutaryl COA synthase; HMG-COA synthase, HMGS, coenzyme A, thiolase fold, condensing enzyme; HET: HMG CAA; 1.60A {Staphylococcus aureus subsp} SCOP: c.95.1.2 c.95.1.2 PDB: 1xpl_A* 1xpk_A* 1tvz_A 1txt_A* Back     alignment and structure
>2hg4_A DEBS, 6-deoxyerythronolide B synthase; ketosynthase, acyltransferase, module 5, transferase; 2.73A {Saccharopolyspora erythraea} Back     alignment and structure
>2wya_A Hydroxymethylglutaryl-COA synthase, mitochondrial; steroid biosynthesis, cholesterol biosynthesis, mitochondrion, phosphoprotein; HET: HMG; 1.70A {Homo sapiens} Back     alignment and structure
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Back     alignment and structure
>3zen_D Fatty acid synthase; transferase, mycolic acid biosynthesis, multifunctional ENZY substrate channeling; HET: FMN; 7.50A {Mycobacterium smegmatis} PDB: 4b3y_A* Back     alignment and structure
>2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-PR; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl RED beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Back     alignment and structure
>2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Back     alignment and structure
>3lma_A Stage V sporulation protein AD (spovad); NESG, structural genomics, PSI-2, protein structure initiative; 1.99A {Bacillus licheniformis} PDB: 3lm6_A Back     alignment and structure
>1hnj_A Beta-ketoacyl-acyl carrier protein synthase III; FABH, transferase; HET: MLC; 1.46A {Escherichia coli} SCOP: c.95.1.2 c.95.1.2 PDB: 1hn9_A* 1hnh_A* 1hnd_A* 1hnk_A 1mzs_A* 2eft_A* 2gyo_A* 3il9_A 1ebl_A* Back     alignment and structure
>1zow_A 3-oxoacyl-[acyl-carrier-protein] synthase III; FABH, fatty acid biosynthesis, transferase; 2.00A {Staphylococcus aureus subsp} PDB: 3il7_A Back     alignment and structure
>1mzj_A Beta-ketoacylsynthase III; beta-ketosynthase, aromatic polyketide, biosynthetic engineering, catalytic triad, transferase; HET: COA; 2.10A {Streptomyces SP} SCOP: c.95.1.2 c.95.1.2 Back     alignment and structure
>2ebd_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, aquifex VF5, lipid metabolism, structural genomics; 2.10A {Aquifex aeolicus} Back     alignment and structure
>1ub7_A 3-oxoacyl-[acyl-carrier protein] synthase; fatty acid synthesis, beta-ketoacyl-ACP synthase III, FABH; 2.30A {Thermus thermophilus} SCOP: c.95.1.2 c.95.1.2 Back     alignment and structure
>2x3e_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; HED, transferase, acyltransferase, lipid synthesis, multifun enzyme; 1.81A {Pseudomonas aeruginosa} Back     alignment and structure
>1u6e_A 3-oxoacyl-[acyl-carrier-protein] synthase III; transferase; 1.85A {Mycobacterium tuberculosis} SCOP: c.95.1.2 c.95.1.2 PDB: 1u6s_A* 1m1m_A 1hzp_A* 2qnx_A* 2qnz_A* 2qo1_A* 2qx1_A* 2qo0_A* 2qny_A* 2ahb_A 2aj9_A Back     alignment and structure
>3h78_A PQS biosynthetic enzyme; PQSD, anthranilic acid, anthraniloyl-COA, transferase; HET: BE2; 1.70A {Pseudomonas aeruginosa PAO1} PDB: 3h76_A 3h77_A* Back     alignment and structure
>4dfe_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; ssgcid, seattle structural genomics center for infectious DI transferase; 2.35A {Burkholderia xenovorans} Back     alignment and structure
>1ulq_A Putative acetyl-COA acetyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 3.00A {Thermus thermophilus} SCOP: c.95.1.1 c.95.1.1 Back     alignment and structure
>3s21_A 3-oxoacyl-[ACP] synthase III; non-decarboxylative claisen condensation reaction, transfera; HET: CER; 1.70A {Xanthomonas campestris PV} PDB: 3s23_A* 3row_A 3s1z_A 3s20_A* 3fk5_A Back     alignment and structure
>4e1l_A Acetoacetyl-COA thiolase 2; 3-layer(ABA) sandwich, transferase; 2.00A {Clostridium difficile} Back     alignment and structure
>3gwa_A 3-oxoacyl-(acyl-carrier-protein) synthase III; structural genomics, synthetase; 1.60A {Burkholderia pseudomallei} PDB: 3gwe_A Back     alignment and structure
>4efi_A 3-oxoacyl-(acyl-carrier protein) synthase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.35A {Burkholderia xenovorans} Back     alignment and structure
>1wl4_A Acetyl-coenzyme A acetyltransferase 2; thiolase fold; HET: COA; 1.55A {Homo sapiens} PDB: 1wl5_A Back     alignment and structure
>2vu1_A Acetyl-COA acetyltransferase; acyltransferase, PHB biosynthesis, thiolase FOL; HET: CSO OPI; 1.51A {Zoogloea ramigera} PDB: 1nl7_A* 1ou6_A* 2vu0_A* 1m4s_A* 2vu2_A* 2wkv_A* 2wku_A* 1m1t_A 1m3k_A 1m1o_A 1m3z_A* 2vtz_A* 2wl5_A* 2wkt_A* 2wl4_A* 1m4t_A* 2wl6_A 1qfl_A* 1dlv_A* 1dlu_A* ... Back     alignment and structure
>3ss6_A Acetyl-COA acetyltransferase; structural genomics, csgid, center for structural genomics O infectious diseases, alpha beta; HET: CSO; 1.70A {Bacillus anthracis} Back     alignment and structure
>3il3_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, fatty acid biosynthesis, antibiotic, acyltransferase, cytoplasm, lipid synthesis; 2.70A {Haemophilus influenzae} Back     alignment and structure
>4dd5_A Acetyl-COA acetyltransferase; structural genomics, center for structural genomics of infec diseases, csgid, thiolase; 1.25A {Clostridium difficile} Back     alignment and structure
>1ted_A PKS18; thiolase fold, substrate binding tunnel, transferase; HET: MYR; 2.25A {Mycobacterium tuberculosis} SCOP: c.95.1.2 PDB: 1tee_A Back     alignment and structure
>4ewp_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; transferase; 2.20A {Micrococcus luteus nctc 2665} Back     alignment and structure
>2ib8_A Acetyl-COA acetyltransferase; thiolase fold, potassium ION, chloride, beta-alpha-beta-ALPH alpha-beta-BETA topology; HET: MES; 1.85A {Homo sapiens} PDB: 2ib7_A* 2ib9_A* 2ibu_A* 2ibw_A* 2iby_A* 2f2s_A* Back     alignment and structure
>1xho_A Chorismate mutase; southeast collaboratory for structural genomics, secsg, protein structure initiative, PSI, structural genomics; 2.20A {Clostridium thermocellum} SCOP: d.79.1.2 Back     alignment and structure
>3tsy_A Fusion protein 4-coumarate--COA ligase 1, resvera synthase; transferase; 3.10A {Arabidospis thaliana} Back     alignment and structure
>3svk_A Acetyl-COA acetyltransferase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.20A {Mycobacterium avium} Back     alignment and structure
>3s3l_A CERJ; acyltransferase, FABH homologue, KS III homologue, dimethyl transfer, transferase; 2.00A {Streptomyces tendae} PDB: 3t5y_A* 3t6s_A* 3t8e_A 3t5y_B* Back     alignment and structure
>3led_A 3-oxoacyl-acyl carrier protein synthase III; structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.45A {Rhodopseudomonas palustris} Back     alignment and structure
>4egv_A Acetyl-COA acetyltransferase; NEW SUB-family, thiolase fold; 2.71A {Mycobacterium smegmatis} Back     alignment and structure
>3r6m_A YEAZ, resuscitation promoting factor; actin/HSP70 nucleotide-binding fold, bacterial resuscitation BUT non-culturable state, Y YJEE; 3.10A {Vibrio parahaemolyticus} Back     alignment and structure
>1tqy_B Actinorhodin polyketide putative beta-ketoacyl SY; alpha-beta-alpha-beta-alpha, heterodimer, transferase; 2.00A {Streptomyces coelicolor} SCOP: c.95.1.1 c.95.1.1 Back     alignment and structure
>2iik_A 3-ketoacyl-COA thiolase, peroxisomal; fatty acid metabolism, structural genomics, structural genom consortium, SGC, transferase; 2.55A {Homo sapiens} Back     alignment and structure
>1dbf_A Protein (chorismate mutase); shikimate pathway, isomerase; 1.30A {Bacillus subtilis} SCOP: d.79.1.2 PDB: 1com_A 2chs_A 2cht_A* 1fnj_A 1fnk_A Back     alignment and structure
>3ho9_A 3-oxoacyl-[acyl-carrier-protein] synthase 2; FABF, platensimycin, platencin A1, KAS2, acyltransferase, fatty acid biosynthesis; HET: N3A; 1.90A {Escherichia coli} PDB: 3hnz_A* 3ho2_A* 3i8p_A* 3g11_A* 2gfx_A* 3g0y_A* 2gfv_A* 2gfw_A 2gfy_A* 1kas_A 1b3n_A Back     alignment and structure
>1u0m_A Putative polyketide synthase; type III polyketide synthase, PKS, bacterial, thiolase fold, beta-alpha-beta-alpha fold, catalytic triad; HET: 15P; 2.22A {Streptomyces coelicolor} SCOP: c.95.1.2 c.95.1.2 Back     alignment and structure
>2gel_A Putative GRAM negative resuscitation promoting FA; YEAZ, RPF, actin-like-fold, glycoprotease, chaperone; 2.05A {Salmonella typhimurium} PDB: 2gem_A 1okj_A Back     alignment and structure
>3kzu_A 3-oxoacyl-(acyl-carrier-protein) synthase II; seattle structural genomics center for infectious disease, ssgcid, acyltransferase; 1.75A {Brucella melitensis} PDB: 3e60_A Back     alignment and structure
>1ufy_A Chorismate mutase; shikimate pathway, mutant, riken structur genomics/proteomics initiative, RSGI, structural genomics,; HET: MES; 0.96A {Thermus thermophilus} SCOP: d.79.1.2 PDB: 1ode_A* 1ui9_A* Back     alignment and structure
>1wdk_C 3-ketoacyl-COA thiolase; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: c.95.1.1 c.95.1.1 PDB: 1wdl_C* 1wdm_C* 2d3t_C* Back     alignment and structure
>1j3n_A 3-oxoacyl-(acyl-carrier protein) synthase II; condensing enzymes, fatty acid elongation, acyl-carrier protein (ACP); HET: CIT; 2.00A {Thermus thermophilus} SCOP: c.95.1.1 c.95.1.1 Back     alignment and structure
>2a6a_A Hypothetical protein TM0874; glycoprotein endopeptidase, structural genomics, JOI for structural genomics, JCSG; 2.50A {Thermotoga maritima} SCOP: c.55.1.9 c.55.1.9 Back     alignment and structure
>4ewg_A Beta-ketoacyl synthase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, transferase; 2.25A {Burkholderia phymatum} Back     alignment and structure
>3o04_A LMO2201 protein, beta-keto-acyl carrier protein synthase II; csgid, structural genomics; 1.85A {Listeria monocytogenes} Back     alignment and structure
>3goa_A 3-ketoacyl-COA thiolase; metabolism, fatty acid, phospholipid, IDP01071, acyltransferase, cytoplasm, fatty acid metabolism; 1.70A {Salmonella typhimurium} Back     alignment and structure
>4ddo_A 3-oxoacyl-[acyl-carrier-protein] synthase 2; ssgcid, struct genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia vietnamiensis} PDB: 4f32_A* Back     alignment and structure
>1tqy_A Beta-ketoacyl synthase/acyl transferase; alpha-beta-alpha-beta-alpha, heterodimer, transferase; 2.00A {Streptomyces coelicolor} SCOP: c.95.1.1 c.95.1.1 Back     alignment and structure
>1ox0_A Beta ketoacyl-acyl carrier protein synthase; transferase; 1.30A {Streptococcus pneumoniae} SCOP: c.95.1.1 c.95.1.1 PDB: 1oxh_A 2alm_A 2rjt_A Back     alignment and structure
>2wge_A 3-oxoacyl-[acyl-carrier-protein] synthase 1; beta ketoacyl synthase I thiolactomycin, cytoplasm, transferase, acyltransferase; HET: TLM; 1.80A {Mycobacterium tuberculosis} PDB: 2wgd_A* 2wgg_A* 2wgf_A* Back     alignment and structure
>2gp6_A 3-oxoacyl-[acyl-carrier-protein] synthase 2; thiolase fold, structural genomics, PSI, protein structure initiative; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2h84_A Steely1; thiolase-fold, type III polyketide synthase, PKS, chalcone-S synthase superfamily, type I PKS; HET: P6G; 2.90A {Dictyostelium discoideum} Back     alignment and structure
>2qo3_A Eryaii erythromycin polyketide synthase modules 3; ketosynthase, acyltransferase, phosphopantetheine, transfera; 2.59A {Saccharopolyspora erythraea} Back     alignment and structure
>2d3m_A Pentaketide chromone synthase; chalcone synthase, polyketide synthase, transferase; HET: COA; 1.60A {Aloe arborescens} PDB: 2d51_A 2d52_A* Back     alignment and structure
>1afw_A 3-ketoacetyl-COA thiolase; fatty acid metabolism; 1.80A {Saccharomyces cerevisiae} SCOP: c.95.1.1 c.95.1.1 PDB: 1pxt_A Back     alignment and structure
>3eno_A Putative O-sialoglycoprotein endopeptidase; hydrolase, metal-binding, metalloprotease, protease, zinc, keops complex, ATPase, metal ION binding; 3.02A {Thermoplasma acidophilum} Back     alignment and structure
>2ivn_A O-sialoglycoprotein endopeptidase; UP1 keops complex, Fe/Zn dependent nucleotide phosphatase, metalloprotease, hypothetical protein, zinc; HET: ANP; 1.65A {Pyrococcus abyssi} PDB: 2ivo_A 2ivp_A* Back     alignment and structure
>3ven_A O-carbamoyltransferase TOBZ; antibiotic biosynthesis, substrate assisted catalysis, subst channeling, adenylation; HET: TLA; 1.57A {Streptoalloteichus tenebrarius} PDB: 3veo_A 3ves_A* 3vet_A* 3vew_A* 3ver_A* 3vf4_A* 3vf2_A* 3vex_A* 3vez_A* Back     alignment and structure
>2wu9_A 3-ketoacyl-COA thiolase 2, peroxisomal; cysteine oxidation, fatty acid metabolism, oxylipin biosynthesis, plant lipid metabolism; 1.50A {Arabidopsis thaliana} PDB: 2c7y_A 2c7z_A 2wua_A Back     alignment and structure
>1e5m_A KAS II, beta ketoacyl acyl carrier protein synthase II; condensing enzyme, biosynthetic role, carbon-carbon bond formation; 1.54A {Synechocystis SP} SCOP: c.95.1.1 c.95.1.1 Back     alignment and structure
>3hhd_A Fatty acid synthase; transferase, multienzyme, megasynthase, fatty acid synthesis, acetylation, cytoplasm, fatty acid biosynthesis, hydrolase; 2.15A {Homo sapiens} PDB: 2jfk_A* 2jfd_A Back     alignment and structure
>2gqd_A 3-oxoacyl-[acyl-carrier-protein] synthase 2; duplicated babababb fold, transferase; 2.30A {Staphylococcus aureus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 110
d1bi5a1235 c.95.1.2 (A:1-235) Chalcone synthase {Alfalfa (Med 8e-08
d1u0ma1200 c.95.1.2 (A:2-201) Putative polyketide synthase SC 8e-06
d1ulqa1 273 c.95.1.1 (A:3-275) Beta-ketoadipyl CoA thiolase {T 2e-04
d1teda_ 372 c.95.1.2 (A:) Polyketide synthase PKS18 {Mycobacte 0.001
>d1bi5a1 c.95.1.2 (A:1-235) Chalcone synthase {Alfalfa (Medicago sativa) [TaxId: 3879]} Length = 235 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Thiolase-like
superfamily: Thiolase-like
family: Chalcone synthase-like
domain: Chalcone synthase
species: Alfalfa (Medicago sativa) [TaxId: 3879]
 Score = 46.3 bits (109), Expect = 8e-08
 Identities = 19/97 (19%), Positives = 31/97 (31%), Gaps = 5/97 (5%)

Query: 6   EDTDYPELAKEALIKALDDAGISINQVQQACCGYVYGD----STCGQRALYQIGMTGIPV 61
              + P L KEA +KA+ + G   +++         G     +      L  +       
Sbjct: 98  VVVEVPRLGKEAAVKAIKEWGQPKSKITHLIVCTTSGVDMPGADYQLTKLLGLRPYVKRY 157

Query: 62  FNVNNNCSTGSSALMLAKQFIESGSDCT-LALGFEKM 97
                 C  G + L LAK   E+      L +  E  
Sbjct: 158 MMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEVT 194


>d1u0ma1 c.95.1.2 (A:2-201) Putative polyketide synthase SCO1206 {Streptomyces coelicolor [TaxId: 1902]} Length = 200 Back     information, alignment and structure
>d1ulqa1 c.95.1.1 (A:3-275) Beta-ketoadipyl CoA thiolase {Thermus thermophilus [TaxId: 274]} Length = 273 Back     information, alignment and structure
>d1teda_ c.95.1.2 (A:) Polyketide synthase PKS18 {Mycobacterium tuberculosis [TaxId: 1773]} Length = 372 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query110
d1hnja1174 Ketoacyl-ACP synthase III (FabH) {Escherichia coli 99.82
d1ulqa1 273 Beta-ketoadipyl CoA thiolase {Thermus thermophilus 99.82
d1u6ea1184 Ketoacyl-ACP synthase III (FabH) {Mycobacterium tu 99.81
d1mzja1181 Priming beta-ketosynthase from the r1128 polyketid 99.8
d1m3ka1 268 Biosynthetic thiolase {Zoogloea ramigera [TaxId: 3 99.8
d1ub7a1172 Ketoacyl-ACP synthase III (FabH) {Thermus thermoph 99.8
d1wdkc1 262 Fatty oxidation complex beta subunit (3-ketoacyl-C 99.78
d1u0ma1200 Putative polyketide synthase SCO1206 {Streptomyces 99.7
d1afwa1 269 Thiolase {Baker's yeast (Saccharomyces cerevisiae) 99.7
d1bi5a1235 Chalcone synthase {Alfalfa (Medicago sativa) [TaxI 99.65
d1teda_ 372 Polyketide synthase PKS18 {Mycobacterium tuberculo 99.62
d1xpma1166 3-hydroxy-3-methylglutaryl CoA synthase MvaS {Stap 99.56
d1j3na1249 Beta-ketoacyl-ACP synthase II {Thermus thermophilu 99.55
d2gfva1250 Beta-ketoacyl-ACP synthase II {Escherichia coli [T 99.49
d1tqyb1208 Actinorhodin polyketide putative beta-ketoacyl syn 99.49
d1tqya1216 Actinorhodin polyketide putative beta-ketoacyl syn 99.49
d1ox0a1256 Beta-ketoacyl-ACP synthase II {Streptococcus pneum 99.45
d1e5ma1250 Beta-ketoacyl-ACP synthase II {Synechocystis sp. [ 99.38
d2vbaa1253 Beta-ketoacyl-ACP synthase I {Escherichia coli [Ta 99.16
d2ix4a1270 Beta-ketoacyl-ACP synthase II {Thale cress (Arabid 99.01
d1ub7a2149 Ketoacyl-ACP synthase III (FabH) {Thermus thermoph 96.74
d1u6ea2148 Ketoacyl-ACP synthase III (FabH) {Mycobacterium tu 96.67
d1hnja2143 Ketoacyl-ACP synthase III (FabH) {Escherichia coli 96.47
d1mzja2153 Priming beta-ketosynthase from the r1128 polyketid 95.76
d1tqyb2194 Actinorhodin polyketide putative beta-ketoacyl syn 94.4
d1ox0a2158 Beta-ketoacyl-ACP synthase II {Streptococcus pneum 94.24
d1xhoa_112 Chorismate mutase {Clostridium thermocellum [TaxId 93.55
d1okja1106 Hypothetical protein YeaZ {Escherichia coli [TaxId 92.91
d2a6aa1103 Hypothetical protein TM0874 {Thermotoga maritima [ 92.49
d1ufya_121 Chorismate mutase {Thermus thermophilus [TaxId: 27 91.27
d1teda_372 Polyketide synthase PKS18 {Mycobacterium tuberculo 90.65
d1dbfa_127 Chorismate mutase {Bacillus subtilis [TaxId: 1423] 90.47
d1u0ma2148 Putative polyketide synthase SCO1206 {Streptomyces 89.72
d1e5ma2161 Beta-ketoacyl-ACP synthase II {Synechocystis sp. [ 88.39
d1afwa2124 Thiolase {Baker's yeast (Saccharomyces cerevisiae) 88.13
d1ulqa2125 Beta-ketoadipyl CoA thiolase {Thermus thermophilus 87.76
d1wdkc2128 Fatty oxidation complex beta subunit (3-ketoacyl-C 86.57
d1m3ka2124 Biosynthetic thiolase {Zoogloea ramigera [TaxId: 3 86.47
d1j3na2159 Beta-ketoacyl-ACP synthase II {Thermus thermophilu 85.81
d2gfva2161 Beta-ketoacyl-ACP synthase II {Escherichia coli [T 85.62
d1tqya2205 Actinorhodin polyketide putative beta-ketoacyl syn 85.03
d2ix4a2161 Beta-ketoacyl-ACP synthase II {Thale cress (Arabid 83.13
>d1hnja1 c.95.1.2 (A:1-174) Ketoacyl-ACP synthase III (FabH) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Thiolase-like
superfamily: Thiolase-like
family: Chalcone synthase-like
domain: Ketoacyl-ACP synthase III (FabH)
species: Escherichia coli [TaxId: 562]
Probab=99.82  E-value=6.4e-20  Score=118.17  Aligned_cols=97  Identities=22%  Similarity=0.350  Sum_probs=88.4

Q ss_pred             CCCCHHHHHHHHHHHHHHHcCCCccccCeEEEEeecCCCcch---hHHHHHcCCCCCCeeeEeccchHHHHHHHHHHHHH
Q psy13271          6 EDTDYPELAKEALIKALDDAGISINQVQQACCGYVYGDSTCG---QRALYQIGMTGIPVFNVNNNCSTGSSALMLAKQFI   82 (110)
Q Consensus         6 ~~~~~~~l~~~a~~~al~~agl~~~~id~vi~~~~~~~~~~~---~~~a~~lg~~~~~~~~i~~~C~sg~~al~~A~~~i   82 (110)
                      ++++..+|+.+|++++|+++++++++||.|++++.++++..|   ..+++.||+++.++++++.+|++++.+|.+|..++
T Consensus        47 ~~~~~~~la~~Aa~~al~~a~~~~~~Id~li~~s~~~~~~~P~~a~~v~~~Lgl~~~~~~di~~~C~g~~~al~~A~~~i  126 (174)
T d1hnja1          47 PNETVSTMGFEAATRAIEMAGIEKDQIGLIVVATTSATHAFPSAACQIQSMLGIKGCPAFDVAAACAGFTYALSVADQYV  126 (174)
T ss_dssp             TTCCHHHHHHHHHHHHHHHHTCCGGGCCEEEEECSCCSCSSSCHHHHHHHHHTCCSSCEEEECCGGGHHHHHHHHHHHHH
T ss_pred             CCccchHHHHHHHHHhhhhcccccccccEEEEecCCccccccchhhhhhhccCCCchhhhhhhhhhccHHHHHHHHHHHH
Confidence            578999999999999999999999999999999998887544   35778999988899999999999999999999999


Q ss_pred             HcC-CCeEEEEeeccCCCCCC
Q psy13271         83 ESG-SDCTLALGFEKMEKGSL  102 (110)
Q Consensus        83 ~sG-~~~vlv~g~e~~s~~~~  102 (110)
                      ++| ++++|++++|..|+...
T Consensus       127 ~sg~~~~~Lvv~~e~~S~~~~  147 (174)
T d1hnja1         127 KSGAVKYALVVGSDVLARTCD  147 (174)
T ss_dssp             HTTSCSEEEEEEEECHHHHSC
T ss_pred             hcCCcceeEEEeeehhhcccC
Confidence            999 99999999999876543



>d1ulqa1 c.95.1.1 (A:3-275) Beta-ketoadipyl CoA thiolase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1mzja1 c.95.1.2 (A:3-183) Priming beta-ketosynthase from the r1128 polyketide biosynthetic pathway {Streptomyces sp. r1128 [TaxId: 140437]} Back     information, alignment and structure
>d1m3ka1 c.95.1.1 (A:1-268) Biosynthetic thiolase {Zoogloea ramigera [TaxId: 350]} Back     information, alignment and structure
>d1ub7a1 c.95.1.2 (A:2-173) Ketoacyl-ACP synthase III (FabH) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wdkc1 c.95.1.1 (C:2-263) Fatty oxidation complex beta subunit (3-ketoacyl-CoA thiolase) {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1u0ma1 c.95.1.2 (A:2-201) Putative polyketide synthase SCO1206 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1afwa1 c.95.1.1 (A:25-293) Thiolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bi5a1 c.95.1.2 (A:1-235) Chalcone synthase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1teda_ c.95.1.2 (A:) Polyketide synthase PKS18 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xpma1 c.95.1.2 (A:2-167) 3-hydroxy-3-methylglutaryl CoA synthase MvaS {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1j3na1 c.95.1.1 (A:1-249) Beta-ketoacyl-ACP synthase II {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2gfva1 c.95.1.1 (A:2-251) Beta-ketoacyl-ACP synthase II {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tqyb1 c.95.1.1 (B:2-209) Actinorhodin polyketide putative beta-ketoacyl synthase 2, KasB {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1tqya1 c.95.1.1 (A:3-218) Actinorhodin polyketide putative beta-ketoacyl synthase 1, KasA {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1e5ma1 c.95.1.1 (A:6-255) Beta-ketoacyl-ACP synthase II {Synechocystis sp. [TaxId: 1143]} Back     information, alignment and structure
>d2vbaa1 c.95.1.1 (A:1-253) Beta-ketoacyl-ACP synthase I {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ix4a1 c.95.1.1 (A:31-300) Beta-ketoacyl-ACP synthase II {Thale cress (Arabidopsis thaliana), mitochondrial isoform [TaxId: 3702]} Back     information, alignment and structure
>d1ub7a2 c.95.1.2 (A:174-322) Ketoacyl-ACP synthase III (FabH) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1u6ea2 c.95.1.2 (A:175-317) Ketoacyl-ACP synthase III (FabH) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1hnja2 c.95.1.2 (A:175-317) Ketoacyl-ACP synthase III (FabH) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mzja2 c.95.1.2 (A:184-336) Priming beta-ketosynthase from the r1128 polyketide biosynthetic pathway {Streptomyces sp. r1128 [TaxId: 140437]} Back     information, alignment and structure
>d1tqyb2 c.95.1.1 (B:210-403) Actinorhodin polyketide putative beta-ketoacyl synthase 2, KasB {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1ox0a2 c.95.1.1 (A:252-409) Beta-ketoacyl-ACP synthase II {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1xhoa_ d.79.1.2 (A:) Chorismate mutase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1okja1 c.55.1.9 (A:1-106) Hypothetical protein YeaZ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a6aa1 c.55.1.9 (A:1-103) Hypothetical protein TM0874 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ufya_ d.79.1.2 (A:) Chorismate mutase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1teda_ c.95.1.2 (A:) Polyketide synthase PKS18 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1dbfa_ d.79.1.2 (A:) Chorismate mutase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1u0ma2 c.95.1.2 (A:202-349) Putative polyketide synthase SCO1206 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1e5ma2 c.95.1.1 (A:256-416) Beta-ketoacyl-ACP synthase II {Synechocystis sp. [TaxId: 1143]} Back     information, alignment and structure
>d1afwa2 c.95.1.1 (A:294-417) Thiolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ulqa2 c.95.1.1 (A:276-400) Beta-ketoadipyl CoA thiolase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wdkc2 c.95.1.1 (C:264-391) Fatty oxidation complex beta subunit (3-ketoacyl-CoA thiolase) {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1m3ka2 c.95.1.1 (A:269-392) Biosynthetic thiolase {Zoogloea ramigera [TaxId: 350]} Back     information, alignment and structure
>d1j3na2 c.95.1.1 (A:250-408) Beta-ketoacyl-ACP synthase II {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2gfva2 c.95.1.1 (A:252-412) Beta-ketoacyl-ACP synthase II {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tqya2 c.95.1.1 (A:219-423) Actinorhodin polyketide putative beta-ketoacyl synthase 1, KasA {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d2ix4a2 c.95.1.1 (A:301-461) Beta-ketoacyl-ACP synthase II {Thale cress (Arabidopsis thaliana), mitochondrial isoform [TaxId: 3702]} Back     information, alignment and structure