Diaphorina citri psyllid: psy13274


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--
IAVNKCEGACNSQVQPSVITPNGFLKECYCCRESYLRERVITLTHCYDPDGMRLTSEKMATLDIKLKEPADCKCYKCGDYSR
ccCCccccccccccccCEEccccccccccccccccEEEEEEEEEcCCcccccccccccccEEEEEEccccccEEEEcccccc
*AVNKCEGACNSQVQPSVITPNGFLKECYCCRESYLRERVITLTHCYDPDGMRLTSEKMATLDIKLKEPADCKCYKCGDY**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
IAVNKCEGACNSQVQPSVITPNGFLKECYCCRESYLRERVITLTHCYDPDGMRLTSEKMATLDIKLKEPADCKCYKCGDYSR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Partner of bursicon Final heterodimeric neurohormone released at the end of the molting cycle, involved in the sclerotization (tanning) of the insect cuticle, melanization and wing spreading.confidentQ566B3
Partner of bursicon Final heterodimeric neurohormone released at the end of the molting cycle, involved in the sclerotization (tanning) of the insect cuticle, melanization and wing spreading. Heterodimer specifically activates the G protein-coupled receptor rk.confidentQ9VJS7
Partner of bursicon Final heterodimeric neurohormone released at the end of the molting cycle, involved in the sclerotization (tanning) of the insect cuticle, melanization and wing spreading.confidentA2VB90

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0001664 [MF]G-protein coupled receptor bindingprobableGO:0005102, GO:0003674, GO:0005488, GO:0005515
GO:0031395 [CC]bursicon neuropeptide hormone complexprobableGO:0043234, GO:0032991, GO:0005615, GO:0005575, GO:0005576, GO:0044421
GO:0007186 [BP]G-protein coupled receptor signaling pathwayprobableGO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007154, GO:0050789, GO:0044699
GO:0007593 [BP]chitin-based cuticle sclerotizationprobableGO:0032502, GO:0032501, GO:0044707, GO:0042303, GO:0007591, GO:0044767, GO:0022404, GO:0008150, GO:0010259, GO:0044699
GO:0018990 [BP]ecdysis, chitin-based cuticleprobableGO:0032501, GO:0044707, GO:0007591, GO:0022404, GO:0008150, GO:0042303, GO:0044699
GO:0090175 [BP]regulation of establishment of planar polarityprobableGO:0022603, GO:0050793, GO:0008150, GO:2000026, GO:2000027, GO:0051239, GO:0065007, GO:0050789

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2K8P, chain A
Confidence level:confident
Coverage over the Query: 3-47,58-75
View the alignment between query and template
View the model in PyMOL