Diaphorina citri psyllid: psy13288

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200

MVLTSFEHSILLILKKSDFTLKISCPRSQLTVQELSLRLVMCVIFREVLLKISSWEKVNLPLYVESQGTSKFRSFGKGDIFNAGSVSRITRHTFAMTPSVGPIVDRKFGQIFNGQILVPKHVLRSLEPKTKVSAIATFPLTVKNFMEKHLKDPYEINLMEELTLKGVTQYYAFVQERQKVHCLNTLFSKCCSLLGVFTCT

cccccccEEHHHHEEccCEEEEccccccccccccccEEEEEEcccHHHHHHHHHHHHccccEEECccccEEEEEEcccccccccccccccccEEEEcccccHHHHcccccccccEEEEEcccccccccccCEEEEECccHHHHHHHHHHcccccEEEEEcccccccEEEEEEEEccccHHHHHHHHHHHccccEEEEEcc

****SFEHSILLILKKSDFTLKISCPRSQLTVQELSLRLVMCVIFREVLLKISSWEKVNLPLYVESQGTSKFRSFGKGDIFNAGSVSRITRHTFAMTPSVGPIVDRKFGQIFNGQILVPKHVLRSLEPKTKVSAIATFPLTVKNFMEKHLKDPYEINLMEELTLKGVTQYYAFVQERQKVHCLNTLFSKCCSLLGVFTCT

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0043933 [BP]	macromolecular complex subunit organization	probable	GO:0008150, GO:0071840, GO:0016043
GO:0005654 [CC]	nucleoplasm	probable	GO:0005575, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0005875 [CC]	microtubule associated complex	probable	GO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0000932 [CC]	cytoplasmic mRNA processing body	probable	GO:0005737, GO:0035770, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0030529, GO:0005575, GO:0044444, GO:0043228, GO:0044424, GO:0032991, GO:0005622, GO:0043226
GO:0010494 [CC]	cytoplasmic stress granule	probable	GO:0005737, GO:0035770, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0030529, GO:0005575, GO:0044444, GO:0043228, GO:0044424, GO:0032991, GO:0005622, GO:0043226
GO:0003723 [MF]	RNA binding	probable	GO:0097159, GO:0003674, GO:1901363, GO:0003676, GO:0005488
GO:0005515 [MF]	protein binding	probable	GO:0003674, GO:0005488
GO:0043186 [CC]	P granule	probable	GO:0005737, GO:0035770, GO:0043232, GO:0060293, GO:0044464, GO:0043229, GO:0005623, GO:0030529, GO:0005575, GO:0044444, GO:0043228, GO:0044424, GO:0032991, GO:0005622, GO:0043226, GO:0045495
GO:0004004 [MF]	ATP-dependent RNA helicase activity	probable	GO:0016787, GO:0016818, GO:0008026, GO:0042623, GO:0003824, GO:0017111, GO:0016817, GO:0004386, GO:0070035, GO:0003724, GO:0003674, GO:0016887, GO:0008186, GO:0016462
GO:0006996 [BP]	organelle organization	probable	GO:0009987, GO:0016043, GO:0008150, GO:0044699, GO:0044763, GO:0071840

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1S2M, chain A
Confidence level:very confident
Coverage over the Query: 15-200
View the alignment between query and template
View the model in PyMOL