Psyllid ID: psy13288

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200
MVLTSFEHSILLILKKSDFTLKISCPRSQLTVQELSLRLVMCVIFREVLLKISSWEKVNLPLYVESQGTSKFRSFGKGDIFNAGSVSRITRHTFAMTPSVGPIVDRKFGQIFNGQILVPKHVLRSLEPKTKVSAIATFPLTVKNFMEKHLKDPYEINLMEELTLKGVTQYYAFVQERQKVHCLNTLFSKCCSLLGVFTCT
cccccccEEHHHHEEccEEEEEccccccccccccccEEEEEEcccHHHHHHHHHHHHccccEEEEccccEEEEEEcccccccccccccccccEEEEccccHHHHHcccccccccEEEEEcccccccccccEEEEEEEccHHHHHHHHHHcccccEEEEEcccccccEEEEEEEEccccHHHHHHHHHHHccccEEEEEcc
cccccHHHHHHHHHcccccEEEcccccccccHHHHHHHHEEEcHHHHHHHHHHHHHHccHHHEEccccEEEEEEEccccccccccEEEEEccEEEEcccccHHHHHHHHHHHccEEEEHHHHHHHccccccEEEEEccccEHHHHHHHHccccEEEcHHHHHHHHccHEHHEEHHHHHHHHHHHHHHHHHHHHHcEEEcc
MVLTSFEHSILLILKKsdftlkiscprsqltVQELSLRLVMCVIFREVLLKISSwekvnlplyvesqgtskfrsfgkgdifnagsvsritrhtfamtpsvgpivdrkfgqifngqilvpkhvlrslepktkvsaiatfPLTVKNFMEKhlkdpyeiNLMEELTLKGVTQYYAFVQERQKVHCLNTLFSKCcsllgvftct
MVLTSFEHSILLILKksdftlkiscprsqltvqelsLRLVMCVIFREVLLKISSWEKVNLPLYVESQGTSKFRSFGKGDIFNAGSVSRITRHTFAMTPSVGPIVDRKFGQIFNGQILVPKHVLRSLEPKTKVSAIATFPLTVKNFMEKHLKDPYEINLMEELTLKGVTQYYAFVQERQKVHCLNTLFSKCCSLLGVFTCT
MVLTSFEHSILLILKKSDFTLKISCPRSQLTVQELSLRLVMCVIFREVLLKISSWEKVNLPLYVESQGTSKFRSFGKGDIFNAGSVSRITRHTFAMTPSVGPIVDRKFGQIFNGQILVPKHVLRSLEPKTKVSAIATFPLTVKNFMEKHLKDPYEINLMEELTLKGVTQYYAFVQERQKVHCLNTLFSKCCSLLGVFTCT
****SFEHSILLILKKSDFTLKISCPRSQLTVQELSLRLVMCVIFREVLLKISSWEKVNLPLYVESQGTSKFRSFGKGDIFNAGSVSRITRHTFAMTPSVGPIVDRKFGQIFNGQILVPKHVLRSLEPKTKVSAIATFPLTVKNFMEKHLKDPYEINLMEELTLKGVTQYYAFVQERQKVHCLNTLFSKCCSLLGVFTC*
*******HSILLILKKSDFTLKISCPRSQLTVQELSLRLVMCVIFREVLLKISSWEKVNLPLYVESQGTSKFRSFGKGDIFNAGSVSRITRHTFAMTPSVGPIVDRKFGQIFNGQILVPKHVLRSLEPKTKVSAIATFPLTVKNFMEKHLKDPYEINLMEELTLKGVTQYYAFVQERQKVHCLNTLFSKCCSLLGVFTCT
MVLTSFEHSILLILKKSDFTLKISCPRSQLTVQELSLRLVMCVIFREVLLKISSWEKVNLPLYVESQGTSKFRSFGKGDIFNAGSVSRITRHTFAMTPSVGPIVDRKFGQIFNGQILVPKHVLRSLEPKTKVSAIATFPLTVKNFMEKHLKDPYEINLMEELTLKGVTQYYAFVQERQKVHCLNTLFSKCCSLLGVFTCT
*VLTSFEHSILLILKKSDFTLKISCPRSQLTVQELSLRLVMCVIFREVLLKISSWEKVNLPLYVESQGTSKFRSFGKGDIFNAGSVSRITRHTFAMTPSVGPIVDRKFGQIFNGQILVPKHVLRSLEPKTKVSAIATFPLTVKNFMEKHLKDPYEINLMEELTLKGVTQYYAFVQERQKVHCLNTLFSKCCSLLGVFTCT
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVLTSFEHSILLILKKSDFTLKISCPRSQLTVQELSLRLVMCVIFREVLLKISSWEKVNLPLYVESQGTSKFRSFGKGDIFNAGSVSRITRHTFAMTPSVGPIVDRKFGQIFNGQILVPKHVLRSLEPKTKVSAIATFPLTVKNFMEKHLKDPYEINLMEELTLKGVTQYYAFVQERQKVHCLNTLFSKCCSLLGVFTCT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query200 2.2.26 [Sep-21-2011]
P23128 459 Putative ATP-dependent RN yes N/A 0.27 0.117 0.962 5e-25
Q6FQU5 507 ATP-dependent RNA helicas yes N/A 0.27 0.106 0.870 1e-21
P39517 506 ATP-dependent RNA helicas yes N/A 0.27 0.106 0.870 1e-21
A6ZXG9 506 ATP-dependent RNA helicas N/A N/A 0.27 0.106 0.870 1e-21
Q09181 485 Putative ATP-dependent RN yes N/A 0.27 0.111 0.851 2e-21
Q75BS4 484 ATP-dependent RNA helicas yes N/A 0.27 0.111 0.851 2e-21
A3LWX3 509 ATP-dependent RNA helicas yes N/A 0.31 0.121 0.718 4e-21
Q1E5R1 512 ATP-dependent RNA helicas N/A N/A 0.335 0.130 0.666 4e-21
A2QY39 505 ATP-dependent RNA helicas yes N/A 0.335 0.132 0.666 7e-21
Q0CBE1 509 ATP-dependent RNA helicas N/A N/A 0.335 0.131 0.666 7e-21
>sp|P23128|DDX6_DROME Putative ATP-dependent RNA helicase me31b OS=Drosophila melanogaster GN=me31B PE=1 SV=3 Back     alignment and function desciption
 Score =  114 bits (284), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 52/54 (96%), Positives = 54/54 (100%)

Query: 136 ATFPLTVKNFMEKHLKDPYEINLMEELTLKGVTQYYAFVQERQKVHCLNTLFSK 189
           ATFPLTVKNFMEKHL++PYEINLMEELTLKGVTQYYAFVQERQKVHCLNTLFSK
Sbjct: 239 ATFPLTVKNFMEKHLREPYEINLMEELTLKGVTQYYAFVQERQKVHCLNTLFSK 292
Unwinds RNA in an ATP-dependent fashion.
Drosophila melanogaster (taxid: 7227)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 3
>sp|Q6FQU5|DHH1_CANGA ATP-dependent RNA helicase DHH1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DHH1 PE=3 SV=1 Back     alignment and function description
>sp|P39517|DHH1_YEAST ATP-dependent RNA helicase DHH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DHH1 PE=1 SV=1 Back     alignment and function description
>sp|A6ZXG9|DHH1_YEAS7 ATP-dependent RNA helicase DHH1 OS=Saccharomyces cerevisiae (strain YJM789) GN=DHH1 PE=3 SV=1 Back     alignment and function description
>sp|Q09181|DHH1_SCHPO Putative ATP-dependent RNA helicase ste13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ste13 PE=3 SV=1 Back     alignment and function description
>sp|Q75BS4|DHH1_ASHGO ATP-dependent RNA helicase DHH1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DHH1 PE=3 SV=1 Back     alignment and function description
>sp|A3LWX3|DHH1_PICST ATP-dependent RNA helicase DHH1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=DHH1 PE=3 SV=1 Back     alignment and function description
>sp|Q1E5R1|DHH1_COCIM ATP-dependent RNA helicase DHH1 OS=Coccidioides immitis (strain RS) GN=DHH1 PE=3 SV=1 Back     alignment and function description
>sp|A2QY39|DHH1_ASPNC ATP-dependent RNA helicase dhh1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=dhh1 PE=3 SV=1 Back     alignment and function description
>sp|Q0CBE1|DHH1_ASPTN ATP-dependent RNA helicase dhh1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=dhh1 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query200
312377194 415 hypothetical protein AND_11577 [Anophele 0.41 0.197 0.693 3e-24
158299881 430 AGAP009135-PA [Anopheles gambiae str. PE 0.41 0.190 0.693 4e-24
156547575 445 PREDICTED: putative ATP-dependent RNA he 0.415 0.186 0.678 8e-24
340728954 444 PREDICTED: putative ATP-dependent RNA he 0.415 0.186 0.678 9e-24
328783051 444 PREDICTED: putative ATP-dependent RNA he 0.415 0.186 0.678 9e-24
307206923 435 Putative ATP-dependent RNA helicase me31 0.415 0.190 0.678 9e-24
383858347 444 PREDICTED: putative ATP-dependent RNA he 0.415 0.186 0.678 9e-24
332020362 444 Putative ATP-dependent RNA helicase me31 0.415 0.186 0.678 1e-23
307168696 443 Putative ATP-dependent RNA helicase me31 0.415 0.187 0.678 1e-23
157118999 439 DEAD box ATP-dependent RNA helicase [Aed 0.41 0.186 0.681 1e-23
>gi|312377194|gb|EFR24088.1| hypothetical protein AND_11577 [Anopheles darlingi] Back     alignment and taxonomy information
 Score =  117 bits (292), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 61/88 (69%), Positives = 68/88 (77%), Gaps = 6/88 (6%)

Query: 104 VDRKFGQIFNGQILVPKHVLRSLEPKTKVSAI--ATFPLTVKNFMEKHLKDPYEINLMEE 161
            D+   Q F G +    HV+  L PK +   +  ATFPL+VKNFMEKHL+DPYEINLMEE
Sbjct: 162 ADKLLSQDFKGML---DHVIMRL-PKERQILLFSATFPLSVKNFMEKHLRDPYEINLMEE 217

Query: 162 LTLKGVTQYYAFVQERQKVHCLNTLFSK 189
           LTLKGVTQYYAFVQERQKVHCLNTLFSK
Sbjct: 218 LTLKGVTQYYAFVQERQKVHCLNTLFSK 245

Source: Anopheles darlingi

Species: Anopheles darlingi

Genus: Anopheles

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|158299881|ref|XP_319893.3| AGAP009135-PA [Anopheles gambiae str. PEST] gi|157013731|gb|EAA14695.3| AGAP009135-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|156547575|ref|XP_001602897.1| PREDICTED: putative ATP-dependent RNA helicase me31b-like isoform 1 [Nasonia vitripennis] gi|345485131|ref|XP_003425200.1| PREDICTED: putative ATP-dependent RNA helicase me31b-like isoform 2 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|340728954|ref|XP_003402776.1| PREDICTED: putative ATP-dependent RNA helicase me31b-like [Bombus terrestris] gi|350412268|ref|XP_003489590.1| PREDICTED: putative ATP-dependent RNA helicase me31b-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|328783051|ref|XP_624586.2| PREDICTED: putative ATP-dependent RNA helicase me31b-like isoform 1 [Apis mellifera] gi|380013249|ref|XP_003690677.1| PREDICTED: putative ATP-dependent RNA helicase me31b-like [Apis florea] Back     alignment and taxonomy information
>gi|307206923|gb|EFN84769.1| Putative ATP-dependent RNA helicase me31b [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|383858347|ref|XP_003704663.1| PREDICTED: putative ATP-dependent RNA helicase me31b-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|332020362|gb|EGI60783.1| Putative ATP-dependent RNA helicase me31b [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|307168696|gb|EFN61728.1| Putative ATP-dependent RNA helicase me31b [Camponotus floridanus] Back     alignment and taxonomy information
>gi|157118999|ref|XP_001659287.1| DEAD box ATP-dependent RNA helicase [Aedes aegypti] gi|108875497|gb|EAT39722.1| AAEL008500-PA [Aedes aegypti] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query200
FB|FBgn0004419 459 me31B "maternal expression at 0.41 0.178 0.674 2.2e-24
SGD|S000002319 506 DHH1 "Cytoplasmic DExD/H-box h 0.325 0.128 0.761 4.3e-21
POMBASE|SPBC776.09 485 ste13 "ATP-dependent RNA helic 0.335 0.138 0.724 1e-20
ZFIN|ZDB-GENE-070912-83 485 ddx6 "DEAD (Asp-Glu-Ala-Asp) b 0.41 0.169 0.581 6.1e-20
UNIPROTKB|E1C8R1 483 DDX6 "Probable ATP-dependent R 0.515 0.213 0.491 1e-19
ASPGD|ASPL0000036135 498 AN10417 [Emericella nidulans ( 0.335 0.134 0.637 1.1e-19
CGD|CAL0006152 549 DHH1 [Candida albicans (taxid: 0.41 0.149 0.558 1.1e-19
UNIPROTKB|Q5AAW3 549 DHH1 "ATP-dependent RNA helica 0.41 0.149 0.558 1.1e-19
UNIPROTKB|Q5ZKB9 483 DDX6 "Probable ATP-dependent R 0.515 0.213 0.491 1.3e-19
UNIPROTKB|E1BDM8 483 DDX6 "Uncharacterized protein" 0.515 0.213 0.491 1.3e-19
FB|FBgn0004419 me31B "maternal expression at 31B" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 282 (104.3 bits), Expect = 2.2e-24, P = 2.2e-24
 Identities = 58/86 (67%), Positives = 65/86 (75%)

Query:   105 DRKFGQIFNGQILVPKHVLRSLEPKTKVSAI-ATFPLTVKNFMEKHLKDPYEINLMEELT 163
             D+     F G +    HV+  L    ++    ATFPLTVKNFMEKHL++PYEINLMEELT
Sbjct:   210 DKLLSLDFQGML---DHVILKLPKDPQILLFSATFPLTVKNFMEKHLREPYEINLMEELT 266

Query:   164 LKGVTQYYAFVQERQKVHCLNTLFSK 189
             LKGVTQYYAFVQERQKVHCLNTLFSK
Sbjct:   267 LKGVTQYYAFVQERQKVHCLNTLFSK 292
GO:0004004 "ATP-dependent RNA helicase activity" evidence=ISS;NAS
GO:0005524 "ATP binding" evidence=IEA
GO:0003723 "RNA binding" evidence=IDA
GO:0000932 "cytoplasmic mRNA processing body" evidence=IDA
GO:0033962 "cytoplasmic mRNA processing body assembly" evidence=IMP
GO:0005875 "microtubule associated complex" evidence=IDA
GO:0005737 "cytoplasm" evidence=IDA
GO:0007095 "mitotic G2 DNA damage checkpoint" evidence=IGI
GO:0043186 "P granule" evidence=IDA
GO:0005515 "protein binding" evidence=IPI
SGD|S000002319 DHH1 "Cytoplasmic DExD/H-box helicase, stimulates mRNA decapping" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
POMBASE|SPBC776.09 ste13 "ATP-dependent RNA helicase Ste13" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-070912-83 ddx6 "DEAD (Asp-Glu-Ala-Asp) box polypeptide 6" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E1C8R1 DDX6 "Probable ATP-dependent RNA helicase DDX6" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ASPGD|ASPL0000036135 AN10417 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
CGD|CAL0006152 DHH1 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
UNIPROTKB|Q5AAW3 DHH1 "ATP-dependent RNA helicase DHH1" [Candida albicans SC5314 (taxid:237561)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZKB9 DDX6 "Probable ATP-dependent RNA helicase DDX6" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E1BDM8 DDX6 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query200
COG0513 513 COG0513, SrmB, Superfamily II DNA and RNA helicase 7e-04
>gnl|CDD|223587 COG0513, SrmB, Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information 
 Score = 39.4 bits (92), Expect = 7e-04
 Identities = 19/59 (32%), Positives = 28/59 (47%), Gaps = 4/59 (6%)

Query: 135 IATFPLTVKNFMEKHLKDPYEINL---MEELTLKGVTQYYAFV-QERQKVHCLNTLFSK 189
            AT P  ++    ++L DP EI +     E TLK + Q+Y  V  E +K+  L  L   
Sbjct: 212 SATMPDDIRELARRYLNDPVEIEVSVEKLERTLKKIKQFYLEVESEEEKLELLLKLLKD 270

Length = 513

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 200
KOG0326|consensus 459 100.0
KOG0328|consensus 400 100.0
KOG0330|consensus 476 100.0
KOG0331|consensus 519 100.0
COG0513 513 SrmB Superfamily II DNA and RNA helicases [DNA rep 100.0
KOG0343|consensus 758 100.0
KOG0345|consensus 567 100.0
KOG0342|consensus 543 99.98
KOG0346|consensus 569 99.97
KOG0338|consensus 691 99.97
KOG0333|consensus 673 99.97
KOG0327|consensus 397 99.97
KOG4284|consensus 980 99.97
KOG0341|consensus 610 99.96
KOG0335|consensus 482 99.96
KOG0339|consensus 731 99.96
KOG0336|consensus 629 99.96
KOG0340|consensus 442 99.96
KOG0332|consensus 477 99.96
KOG0329|consensus387 99.95
KOG0348|consensus 708 99.95
PRK11776 460 ATP-dependent RNA helicase DbpA; Provisional 99.95
KOG0337|consensus 529 99.95
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 99.94
PTZ00110 545 helicase; Provisional 99.94
KOG0347|consensus 731 99.94
KOG0334|consensus 997 99.93
PRK04837 423 ATP-dependent RNA helicase RhlB; Provisional 99.93
PRK10590 456 ATP-dependent RNA helicase RhlE; Provisional 99.93
PRK04537 572 ATP-dependent RNA helicase RhlB; Provisional 99.93
PLN00206 518 DEAD-box ATP-dependent RNA helicase; Provisional 99.92
PRK11192 434 ATP-dependent RNA helicase SrmB; Provisional 99.91
PRK01297 475 ATP-dependent RNA helicase RhlB; Provisional 99.9
KOG0350|consensus 620 99.9
PTZ00424 401 helicase 45; Provisional 99.87
TIGR02621 844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 99.83
PRK09401 1176 reverse gyrase; Reviewed 99.81
KOG0344|consensus 593 99.77
PRK14701 1638 reverse gyrase; Provisional 99.74
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 99.73
TIGR03817 742 DECH_helic helicase/secretion neighborhood putativ 99.73
PHA02653 675 RNA helicase NPH-II; Provisional 99.63
KOG0349|consensus 725 99.62
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 99.58
TIGR01970 819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 99.57
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 99.57
TIGR01587 358 cas3_core CRISPR-associated helicase Cas3. This mo 99.5
PRK10689 1147 transcription-repair coupling factor; Provisional 99.47
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 99.47
TIGR00614 470 recQ_fam ATP-dependent DNA helicase, RecQ family. 99.46
PRK02362 737 ski2-like helicase; Provisional 99.42
TIGR00580 926 mfd transcription-repair coupling factor (mfd). Al 99.41
PRK00254 720 ski2-like helicase; Provisional 99.41
PLN03137 1195 ATP-dependent DNA helicase; Q4-like; Provisional 99.4
PRK10917 681 ATP-dependent DNA helicase RecG; Provisional 99.37
PRK11057 607 ATP-dependent DNA helicase RecQ; Provisional 99.35
PRK13767 876 ATP-dependent helicase; Provisional 99.3
PRK01172 674 ski2-like helicase; Provisional 99.28
TIGR01389 591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 99.26
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 99.24
TIGR00643 630 recG ATP-dependent DNA helicase RecG. 99.21
PRK11131 1294 ATP-dependent RNA helicase HrpA; Provisional 99.16
PRK12898 656 secA preprotein translocase subunit SecA; Reviewed 98.99
PHA02558 501 uvsW UvsW helicase; Provisional 98.98
PRK12899 970 secA preprotein translocase subunit SecA; Reviewed 98.94
PRK05580 679 primosome assembly protein PriA; Validated 98.82
TIGR03158357 cas3_cyano CRISPR-associated helicase, Cyano-type. 98.81
COG1204 766 Superfamily II helicase [General function predicti 98.61
PRK13104 896 secA preprotein translocase subunit SecA; Reviewed 98.6
smart00487201 DEXDc DEAD-like helicases superfamily. 98.57
TIGR01967 1283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 98.56
PRK09200 790 preprotein translocase subunit SecA; Reviewed 98.55
TIGR00963 745 secA preprotein translocase, SecA subunit. The pro 98.46
TIGR00595 505 priA primosomal protein N'. All proteins in this f 98.33
TIGR03714 762 secA2 accessory Sec system translocase SecA2. Memb 98.32
PRK13766 773 Hef nuclease; Provisional 98.13
PRK12904 830 preprotein translocase subunit SecA; Reviewed 98.07
PRK13107 908 preprotein translocase subunit SecA; Reviewed 97.88
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 97.86
COG1205 851 Distinct helicase family with a unique C-terminal 97.85
PF06862 442 DUF1253: Protein of unknown function (DUF1253); In 97.7
COG1201 814 Lhr Lhr-like helicases [General function predictio 97.65
COG1202 830 Superfamily II helicase, archaea-specific [General 97.5
KOG0952|consensus 1230 97.47
PRK09694 878 helicase Cas3; Provisional 97.37
TIGR00603 732 rad25 DNA repair helicase rad25. All proteins in t 96.98
PRK07246 820 bifunctional ATP-dependent DNA helicase/DNA polyme 96.85
COG0514 590 RecQ Superfamily II DNA helicase [DNA replication, 96.38
COG1061 442 SSL2 DNA or RNA helicases of superfamily II [Trans 96.3
TIGR03117 636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase 96.24
KOG0951|consensus 1674 95.56
TIGR00348 667 hsdR type I site-specific deoxyribonuclease, HsdR 95.4
COG1111 542 MPH1 ERCC4-like helicases [DNA replication, recomb 95.28
COG4581 1041 Superfamily II RNA helicase [DNA replication, reco 95.09
KOG2340|consensus 698 94.68
TIGR01407 850 dinG_rel DnaQ family exonuclease/DinG family helic 94.24
PF07652148 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR 93.72
COG1203 733 CRISPR-associated helicase Cas3 [Defense mechanism 92.96
COG4098 441 comFA Superfamily II DNA/RNA helicase required for 92.89
PRK14873 665 primosome assembly protein PriA; Provisional 92.53
KOG0354|consensus 746 91.28
COG1198 730 PriA Primosomal protein N' (replication factor Y) 91.17
KOG0947|consensus 1248 86.71
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 86.38
CHL00122 870 secA preprotein translocase subunit SecA; Validate 85.49
COG1643 845 HrpA HrpA-like helicases [DNA replication, recombi 84.71
KOG0351|consensus 941 83.71
KOG0948|consensus 1041 83.25
PF00176299 SNF2_N: SNF2 family N-terminal domain; InterPro: I 83.16
PRK12326 764 preprotein translocase subunit SecA; Reviewed 81.8
>KOG0326|consensus Back     alignment and domain information 
Probab=100.00  E-value=2e-41  Score=283.37  Aligned_cols=181  Identities=42%  Similarity=0.607  Sum_probs=168.8

Q ss_pred             hhHHhHhhhcCc----------cEEEecCcc-cccccCCCCeeEEEEcCCHHHHHHHHHHhh-----cCCcEEEEeCCcc
Q psy13288          7 EHSILLILKKSD----------FTLKISCPR-SQLTVQELSLRLVMCVIFREVLLKISSWEK-----VNLPLYVESQGTS   70 (200)
Q Consensus         7 ~~~i~~~l~~~~----------~~l~~~~p~-~~~~~~~~~~~~lIl~PTRELa~Qi~~~~~-----~~l~~~~~~gg~~   70 (200)
                      ++|||-+|.++|          +|.+|.+|. +++++..+.+|++|+|||||||+|++++++     .+++++...||++
T Consensus       113 eesIPiaLtGrdiLaRaKNGTGKT~a~~IP~Lekid~~~~~IQ~~ilVPtrelALQtSqvc~~lskh~~i~vmvttGGT~  192 (459)
T KOG0326|consen  113 EESIPIALTGRDILARAKNGTGKTAAYCIPVLEKIDPKKNVIQAIILVPTRELALQTSQVCKELSKHLGIKVMVTTGGTS  192 (459)
T ss_pred             ccccceeecchhhhhhccCCCCCccceechhhhhcCccccceeEEEEeecchhhHHHHHHHHHHhcccCeEEEEecCCcc
Confidence            468888887765          677899998 789999999999999999999999999998     7899999999999


Q ss_pred             ccccCCCCceeee--------cccccee------------eeeeeecCCCCChhhccccccchhhhhcHHHHHhhCCCCc
Q psy13288         71 KFRSFGKGDIFNA--------GSVSRIT------------RHTFAMTPSVGPIVDRKFGQIFNGQILVPKHVLRSLEPKT  130 (200)
Q Consensus        71 ~~~~~~~~~~~~~--------~TPgrl~------------~~~~v~d~~~~DEAD~ll~~~f~~~i~~i~~i~~~l~~~~  130 (200)
                      .     +.++.|+        |||||++            +.++|+     ||||+||+.+|++.+   +.++..+|+++
T Consensus       193 l-----rDDI~Rl~~~VH~~vgTPGRIlDL~~KgVa~ls~c~~lV~-----DEADKlLs~~F~~~~---e~li~~lP~~r  259 (459)
T KOG0326|consen  193 L-----RDDIMRLNQTVHLVVGTPGRILDLAKKGVADLSDCVILVM-----DEADKLLSVDFQPIV---EKLISFLPKER  259 (459)
T ss_pred             c-----ccceeeecCceEEEEcCChhHHHHHhcccccchhceEEEe-----chhhhhhchhhhhHH---HHHHHhCCccc
Confidence            9     8888776        9999998            456666     677999999999998   99999999999


Q ss_pred             EE-EEEeeCchhHHHHHHHhCCCCeEEEeccccccccceEEEEEcccccHHHHHHHHHhhCCCCeEEEEeC
Q psy13288        131 KV-SAIATFPLTVKNFMEKHLKDPYEINLMEELTLKGVTQYYAFVQERQKVHCLNTLFSKCCSLLGVFTCT  200 (200)
Q Consensus       131 Q~-lfSAT~~~~v~~~~~~~l~~~~~i~v~~~~~~~~i~q~~i~~~~~~K~~~L~~ll~~~~~~k~iIF~n  200 (200)
                      |+ |||||||-.|+.+.+++|++|+.|.+.++.++.+++|||-+|++.+|+.+|..|+.++..+|+|||||
T Consensus       260 QillySATFP~tVk~Fm~~~l~kPy~INLM~eLtl~GvtQyYafV~e~qKvhCLntLfskLqINQsIIFCN  330 (459)
T KOG0326|consen  260 QILLYSATFPLTVKGFMDRHLKKPYEINLMEELTLKGVTQYYAFVEERQKVHCLNTLFSKLQINQSIIFCN  330 (459)
T ss_pred             eeeEEecccchhHHHHHHHhccCcceeehhhhhhhcchhhheeeechhhhhhhHHHHHHHhcccceEEEec
Confidence            99 99999999999999999999999999999999999999999999999999999999999999999998

>KOG0328|consensus Back     alignment and domain information
>KOG0330|consensus Back     alignment and domain information
>KOG0331|consensus Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0343|consensus Back     alignment and domain information
>KOG0345|consensus Back     alignment and domain information
>KOG0342|consensus Back     alignment and domain information
>KOG0346|consensus Back     alignment and domain information
>KOG0338|consensus Back     alignment and domain information
>KOG0333|consensus Back     alignment and domain information
>KOG0327|consensus Back     alignment and domain information
>KOG4284|consensus Back     alignment and domain information
>KOG0341|consensus Back     alignment and domain information
>KOG0335|consensus Back     alignment and domain information
>KOG0339|consensus Back     alignment and domain information
>KOG0336|consensus Back     alignment and domain information
>KOG0340|consensus Back     alignment and domain information
>KOG0332|consensus Back     alignment and domain information
>KOG0329|consensus Back     alignment and domain information
>KOG0348|consensus Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>KOG0337|consensus Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>KOG0347|consensus Back     alignment and domain information
>KOG0334|consensus Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0350|consensus Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>KOG0344|consensus Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>KOG0349|consensus Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>PRK12899 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>PRK13104 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>PRK09200 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>PRK12904 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK13107 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>PF06862 DUF1253: Protein of unknown function (DUF1253); InterPro: IPR010678 This family is defined by a C-terminal region of approximately 500 residues, Digestive organ expansion factor (DEF) is thought to Regulate the p53 pathway to control the expansion growth of digestive organs and is required for the expansion growth of intestine, liver and exocrine pancreas, but not endocrine pancreas [, ] Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>COG1202 Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>KOG0952|consensus Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>KOG0951|consensus Back     alignment and domain information
>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG2340|consensus Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain Back     alignment and domain information
>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>KOG0354|consensus Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0947|consensus Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>CHL00122 secA preprotein translocase subunit SecA; Validated Back     alignment and domain information
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0351|consensus Back     alignment and domain information
>KOG0948|consensus Back     alignment and domain information
>PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e Back     alignment and domain information
>PRK12326 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query200
1s2m_A 400 Crystal Structure Of The Dead Box Protein Dhh1p Len 9e-23
2wax_A 193 Structure Of The Human Ddx6 C-Terminal Domain In Co 1e-15
>pdb|1S2M|A Chain A, Crystal Structure Of The Dead Box Protein Dhh1p Length = 400 Back     alignment and structure 
Iteration: 1

 Score =  103 bits (256), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 50/54 (92%)
Query: 136 ATFPLTVKNFMEKHLKDPYEINLMEELTLKGVTQYYAFVQERQKVHCLNTLFSK 189
           ATFPLTVK FM KHL  PYEINLMEELTLKG+TQYYAFV+ERQK+HCLNTLFSK
Sbjct: 202 ATFPLTVKEFMVKHLHKPYEINLMEELTLKGITQYYAFVEERQKLHCLNTLFSK 255
>pdb|2WAX|A Chain A, Structure Of The Human Ddx6 C-Terminal Domain In Complex With An Edc3-Fdf Peptide Length = 193 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query200
1s2m_A 400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 5e-22
3eiq_A 414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 2e-17
1xti_A 391 Probable ATP-dependent RNA helicase P47; alpha-bet 4e-17
1fuu_A 394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 4e-17
2j0s_A 410 ATP-dependent RNA helicase DDX48; mRNA processing, 1e-16
3fmp_B 479 ATP-dependent RNA helicase DDX19B; nuclear porin, 4e-14
3fht_A 412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 7e-13
3fho_A 508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 2e-10
3pey_A 395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 1e-07
1t5i_A 172 C_terminal domain of A probable ATP-dependent RNA 3e-06
2rb4_A 175 ATP-dependent RNA helicase DDX25; rossmann fold, s 6e-05
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 7e-05
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 2e-04
3sqw_A 579 ATP-dependent RNA helicase MSS116, mitochondrial; 6e-04
1hv8_A 367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 7e-04
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 7e-04
3i5x_A 563 ATP-dependent RNA helicase MSS116; protein-RNA com 7e-04
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Length = 400 Back     alignment and structure
 Score = 91.1 bits (227), Expect = 5e-22
 Identities = 52/79 (65%), Positives = 58/79 (73%), Gaps = 4/79 (5%)

Query: 112 FNGQILVPKHVLRSLEPKTKVSAI-ATFPLTVKNFMEKHLKDPYEINLMEELTLKGVTQY 170
           F   I   + +L  L P  +     ATFPLTVK FM KHL  PYEINLMEELTLKG+TQY
Sbjct: 180 FKTII---EQILSFLPPTHQSLLFSATFPLTVKEFMVKHLHKPYEINLMEELTLKGITQY 236

Query: 171 YAFVQERQKVHCLNTLFSK 189
           YAFV+ERQK+HCLNTLFSK
Sbjct: 237 YAFVEERQKLHCLNTLFSK 255
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Length = 414 Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Length = 391 Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Length = 394 Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Length = 410 Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Length = 479 Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Length = 412 Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Length = 395 Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Length = 172 Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Length = 175 Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Length = 206 Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Length = 300 Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Length = 579 Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Length = 367 Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Length = 230 Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* Length = 563 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query200
2db3_A 434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 99.93
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 99.9
3fmp_B 479 ATP-dependent RNA helicase DDX19B; nuclear porin, 99.88
2j0s_A 410 ATP-dependent RNA helicase DDX48; mRNA processing, 99.88
2i4i_A 417 ATP-dependent RNA helicase DDX3X; DEAD, structural 99.87
3eiq_A 414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 99.87
3fht_A 412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 99.86
1s2m_A 400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 99.85
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 99.85
1xti_A 391 Probable ATP-dependent RNA helicase P47; alpha-bet 99.84
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 99.84
3pey_A 395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 99.84
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 99.83
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 99.82
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 99.82
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 99.82
1fuu_A 394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 99.82
3bor_A237 Human initiation factor 4A-II; translation initiat 99.81
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 99.8
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 99.8
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 99.79
3sqw_A 579 ATP-dependent RNA helicase MSS116, mitochondrial; 99.78
1hv8_A 367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 99.78
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 99.78
3i5x_A 563 ATP-dependent RNA helicase MSS116; protein-RNA com 99.78
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 99.77
3fho_A 508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 99.77
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 99.77
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 99.77
3oiy_A 414 Reverse gyrase helicase domain; topoisomerase, DNA 99.73
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 99.73
2z0m_A 337 337AA long hypothetical ATP-dependent RNA helicase 99.73
1tf5_A 844 Preprotein translocase SECA subunit; ATPase, helic 99.73
2fsf_A 853 Preprotein translocase SECA subunit; ATPase, DNA-R 99.72
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 99.68
1nkt_A 922 Preprotein translocase SECA 1 subunit; preprotein 99.65
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 99.63
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealin 99.57
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 99.49
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 99.49
3o8b_A 666 HCV NS3 protease/helicase; ntpase, RNA, translocat 99.45
2whx_A 618 Serine protease/ntpase/helicase NS3; transcription 99.44
1oyw_A 523 RECQ helicase, ATP-dependent DNA helicase; winged 99.43
4a2p_A 556 RIG-I, retinoic acid inducible protein I; hydrolas 99.42
3tbk_A 555 RIG-I helicase domain; DECH helicase, ATP binding, 99.4
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 99.37
1yks_A 440 Genome polyprotein [contains: flavivirin protease 99.37
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 99.34
4a2q_A 797 RIG-I, retinoic acid inducible protein I; hydrolas 99.33
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 99.32
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 99.31
2ykg_A 696 Probable ATP-dependent RNA helicase DDX58; hydrola 99.29
2fwr_A 472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 99.26
4a2w_A 936 RIG-I, retinoic acid inducible protein I; hydrolas 99.25
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 99.24
2wv9_A 673 Flavivirin protease NS2B regulatory subunit, FLAV 99.22
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 99.18
2v6i_A 431 RNA helicase; membrane, hydrolase, transmembrane, 99.18
1wp9_A 494 ATP-dependent RNA helicase, putative; ATPase, DNA 99.18
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 99.17
2jlq_A 451 Serine protease subunit NS3; ribonucleoprotein, nu 99.16
2z83_A 459 Helicase/nucleoside triphosphatase; hydrolase, mem 99.13
2oca_A 510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 99.11
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 99.07
1rif_A282 DAR protein, DNA helicase UVSW; bacteriophage, REC 99.05
3h1t_A 590 Type I site-specific restriction-modification syst 99.03
1gm5_A 780 RECG; helicase, replication restart; HET: DNA ADP; 99.01
4gl2_A 699 Interferon-induced helicase C domain-containing P; 98.91
3rc3_A 677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 98.86
3b6e_A216 Interferon-induced helicase C domain-containing P; 98.83
2ipc_A 997 Preprotein translocase SECA subunit; nucleotide bi 98.78
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 98.39
2w00_A 1038 HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri 98.32
1z63_A 500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 98.02
3crv_A 551 XPD/RAD3 related DNA helicase; XPD helicase DNA re 97.88
2p6n_A 191 ATP-dependent RNA helicase DDX41; DEAD, structural 97.78
2d7d_A 661 Uvrabc system protein B; helicase, protein-DNA-ADP 97.74
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 97.41
3mwy_W 800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 96.1
1c4o_A 664 DNA nucleotide excision repair enzyme UVRB; uvrabc 96.05
4a15_A 620 XPD helicase, ATP-dependent DNA helicase TA0057; h 95.25
1w36_D 608 RECD, exodeoxyribonuclease V alpha chain; recombin 95.15
2vl7_A 540 XPD; helicase, unknown function; 2.25A {Sulfolobus 93.99
1z3i_X 644 Similar to RAD54-like; recombination ATPase helica 90.72
3jux_A 822 Protein translocase subunit SECA; protein transloc 90.1
3jux_A 822 Protein translocase subunit SECA; protein transloc 87.03
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
Probab=99.93  E-value=5e-26  Score=200.71  Aligned_cols=176  Identities=16%  Similarity=0.136  Sum_probs=141.9

Q ss_pred             hcCccEEEecCccc-ccc-----cCCCCeeEEEEcCCHHHHHHHHHHhh-----cCCcEEEEeCCcccccc----CCCCc
Q psy13288         15 KKSDFTLKISCPRS-QLT-----VQELSLRLVMCVIFREVLLKISSWEK-----VNLPLYVESQGTSKFRS----FGKGD   79 (200)
Q Consensus        15 ~~~~~~l~~~~p~~-~~~-----~~~~~~~~lIl~PTRELa~Qi~~~~~-----~~l~~~~~~gg~~~~~~----~~~~~   79 (200)
                      .|+|+|+++..|.. ++.     ....++++||++||||||.|++++++     .++++..++||.+...+    ....+
T Consensus       102 TGsGKT~a~~lpil~~l~~~~~~~~~~~~~~lil~PtreLa~Q~~~~~~~~~~~~~~~~~~~~gg~~~~~~~~~l~~~~~  181 (434)
T 2db3_A          102 TGSGKTAAFLLPILSKLLEDPHELELGRPQVVIVSPTRELAIQIFNEARKFAFESYLKIGIVYGGTSFRHQNECITRGCH  181 (434)
T ss_dssp             TTSSHHHHHHHHHHHHHHHSCCCCCTTCCSEEEECSSHHHHHHHHHHHHHHTTTSSCCCCEECTTSCHHHHHHHHTTCCS
T ss_pred             CCCCchHHHHHHHHHHHHhcccccccCCccEEEEecCHHHHHHHHHHHHHHhccCCcEEEEEECCCCHHHHHHHhhcCCC
Confidence            34666776777763 222     22357899999999999999999988     56888999999875211    11234


Q ss_pred             eeeecccccee------------eeeeeecCCCCChhhccccccchhhhhcHHHHHhhC--CCCcEE-EEEeeCchhHHH
Q psy13288         80 IFNAGSVSRIT------------RHTFAMTPSVGPIVDRKFGQIFNGQILVPKHVLRSL--EPKTKV-SAIATFPLTVKN  144 (200)
Q Consensus        80 ~~~~~TPgrl~------------~~~~v~d~~~~DEAD~ll~~~f~~~i~~i~~i~~~l--~~~~Q~-lfSAT~~~~v~~  144 (200)
                      +. ++||||+.            ..++|+     ||||+|++.||.+++   ..+++.+  +.++|+ +||||+|.++++
T Consensus       182 Iv-v~Tp~~l~~~l~~~~~~l~~~~~lVl-----DEah~~~~~gf~~~~---~~i~~~~~~~~~~q~l~~SAT~~~~~~~  252 (434)
T 2db3_A          182 VV-IATPGRLLDFVDRTFITFEDTRFVVL-----DEADRMLDMGFSEDM---RRIMTHVTMRPEHQTLMFSATFPEEIQR  252 (434)
T ss_dssp             EE-EECHHHHHHHHHTTSCCCTTCCEEEE-----ETHHHHTSTTTHHHH---HHHHHCTTSCSSCEEEEEESCCCHHHHH
T ss_pred             EE-EEChHHHHHHHHhCCcccccCCeEEE-----ccHhhhhccCcHHHH---HHHHHhcCCCCCceEEEEeccCCHHHHH
Confidence            44 79999997            234455     778999999999998   8998875  678999 999999999999


Q ss_pred             HHHHhCCCCeEEEec-cccccccceEEEEEcccccHHHHHHHHHhhCCCCeEEEEeC
Q psy13288        145 FMEKHLKDPYEINLM-EELTLKGVTQYYAFVQERQKVHCLNTLFSKCCSLLGVFTCT  200 (200)
Q Consensus       145 ~~~~~l~~~~~i~v~-~~~~~~~i~q~~i~~~~~~K~~~L~~ll~~~~~~k~iIF~n  200 (200)
                      ++..+++++..+.+. ......++.|.+..++..+|...|..++..... ++|||||
T Consensus       253 ~~~~~l~~~~~i~~~~~~~~~~~i~~~~~~~~~~~k~~~l~~~l~~~~~-~~lVF~~  308 (434)
T 2db3_A          253 MAGEFLKNYVFVAIGIVGGACSDVKQTIYEVNKYAKRSKLIEILSEQAD-GTIVFVE  308 (434)
T ss_dssp             HHHTTCSSCEEEEESSTTCCCTTEEEEEEECCGGGHHHHHHHHHHHCCT-TEEEECS
T ss_pred             HHHHhccCCEEEEeccccccccccceEEEEeCcHHHHHHHHHHHHhCCC-CEEEEEe
Confidence            999999999999887 566678899999999999999999999988654 4999997
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure
>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Back     alignment and structure
>2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* Back     alignment and structure
>3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 200
d1s2ma2 171 c.37.1.19 (A:252-422) Putative ATP-dependent RNA h 8e-06
d1s2ma1206 c.37.1.19 (A:46-251) Putative ATP-dependent RNA he 5e-04
d2j0sa2 168 c.37.1.19 (A:244-411) Probable ATP-dependent RNA h 0.002
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 171 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Putative ATP-dependent RNA helicase DHH1
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

 Score = 42.3 bits (98), Expect = 8e-06
 Identities = 26/29 (89%), Positives = 29/29 (100%)

Query: 161 ELTLKGVTQYYAFVQERQKVHCLNTLFSK 189
           ELTLKG+TQYYAFV+ERQK+HCLNTLFSK
Sbjct: 1   ELTLKGITQYYAFVEERQKLHCLNTLFSK 29
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 206 Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Length = 168 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query200
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 99.96
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 99.95
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 99.94
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 99.94
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 99.92
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 99.91
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 99.9
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 99.9
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 99.82
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 99.22
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.06
d2bmfa2 305 Dengue virus helicase {Dengue virus type 2 [TaxId: 98.99
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 98.98
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 98.71
d1rifa_282 DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] 97.65
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 97.64
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 97.6
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 96.98
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 96.13
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 95.35
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Probable ATP-dependent RNA helicase DDX48
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.96  E-value=3.3e-31  Score=213.83  Aligned_cols=143  Identities=23%  Similarity=0.246  Sum_probs=121.5

Q ss_pred             hHHhHhhh----------cCccEEEecCcc-cccccCCCCeeEEEEcCCHHHHHHHHHHhh-----cCCcEEEEeCCccc
Q psy13288          8 HSILLILK----------KSDFTLKISCPR-SQLTVQELSLRLVMCVIFREVLLKISSWEK-----VNLPLYVESQGTSK   71 (200)
Q Consensus         8 ~~i~~~l~----------~~~~~l~~~~p~-~~~~~~~~~~~~lIl~PTRELa~Qi~~~~~-----~~l~~~~~~gg~~~   71 (200)
                      .+||.+|+          |+|+|++|.+|. +++......++++|++||||||.|++++++     .++++..++||.+.
T Consensus        46 ~aIp~il~g~dvi~~a~TGSGKTlayllPil~~l~~~~~~~~~lil~PtreLa~Qi~~~~~~l~~~~~i~~~~~~g~~~~  125 (222)
T d2j0sa1          46 RAIKQIIKGRDVIAQSQSGTGKTATFSISVLQCLDIQVRETQALILAPTRELAVQIQKGLLALGDYMNVQCHACIGGTNV  125 (222)
T ss_dssp             HHHHHHHTTCCEEEECCTTSSHHHHHHHHHHHTCCTTSCSCCEEEECSSHHHHHHHHHHHHHHTTTTTCCEEEECTTSCH
T ss_pred             HHHHHHHCCCCeEEEcCcchhhhhhhcccccccccccccCceeEEecchHHHHHHHHHHHHHHhCccceeEEEEeecccc
Confidence            46777777          677888899998 677788889999999999999999999998     68899999999875


Q ss_pred             ccc---C-CCCceeeecccccee------------eeeeeecCCCCChhhccccccchhhhhcHHHHHhhCCCCcEE-EE
Q psy13288         72 FRS---F-GKGDIFNAGSVSRIT------------RHTFAMTPSVGPIVDRKFGQIFNGQILVPKHVLRSLEPKTKV-SA  134 (200)
Q Consensus        72 ~~~---~-~~~~~~~~~TPgrl~------------~~~~v~d~~~~DEAD~ll~~~f~~~i~~i~~i~~~l~~~~Q~-lf  134 (200)
                      ...   . ...+++ +|||||+.            ++++|+     ||||+|++.||.+++   ..|++++|+++|+ +|
T Consensus       126 ~~~~~~l~~~~~Il-v~TPgrl~~~~~~~~~~~~~l~~lVl-----DEaD~ll~~~f~~~i---~~I~~~l~~~~Q~ilf  196 (222)
T d2j0sa1         126 GEDIRKLDYGQHVV-AGTPGRVFDMIRRRSLRTRAIKMLVL-----DEADEMLNKGFKEQI---YDVYRYLPPATQVVLI  196 (222)
T ss_dssp             HHHHHHHHHCCSEE-EECHHHHHHHHHTTSSCCTTCCEEEE-----ETHHHHTSTTTHHHH---HHHHTTSCTTCEEEEE
T ss_pred             hhhHHHhccCCeEE-eCCCCcHHhcccccccccccceeeee-----cchhHhhhcCcHHHH---HHHHHhCCCCCEEEEE
Confidence            221   1 123444 79999997            456666     677999999999998   9999999999999 99


Q ss_pred             EeeCchhHHHHHHHhCCCCeEEEec
Q psy13288        135 IATFPLTVKNFMEKHLKDPYEINLM  159 (200)
Q Consensus       135 SAT~~~~v~~~~~~~l~~~~~i~v~  159 (200)
                      |||+|++++++++.+++||+.|.++
T Consensus       197 SAT~~~~v~~l~~~~l~~Pv~I~V~  221 (222)
T d2j0sa1         197 SATLPHEILEMTNKFMTDPIRILVK  221 (222)
T ss_dssp             ESCCCHHHHTTGGGTCSSCEEECCC
T ss_pred             EEeCCHHHHHHHHHHCCCCEEEEEe
Confidence            9999999999999999999998764
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure