Diaphorina citri psyllid: psy13291


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------9
MKKKKKKKKKKPELGLARLDPDSEWSFRITFTVNTQEHKRLLTDLDICMRSSDCAHTVQFYGAMFREGDVWICMEVMDTSLDKFYTKVD
cccccccccccccccccccccCEEEEEEEEEcccHHHHHHHHHHHHHHHHcccccccEEEEEEEEEccEEEEEEccHHccHHHHHcccc
*******************DPDSEWSFRITFTVNTQEHKRLLTDLDICMRSSDCAHTVQFYGAMFREGDVWICMEVMDTSLDKFYTKV*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKKKKKKKKKKPELGLARLDPDSEWSFRITFTVNTQEHKRLLTDLDICMRSSDCAHTVQFYGAMFREGDVWICMEVMDTSLDKFYTKVD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Dual specificity mitogen-activated protein kinase kinase 6 Dual specificity protein kinase which acts as an essential component of the MAP kinase signal transduction pathway. With MAP3K3/MKK3, catalyzes the concomitant phosphorylation of a threonine and a tyrosine residue in the MAP kinases p38 MAPK11, MAPK12, MAPK13 and MAPK14 and plays an important role in the regulation of cellular responses to cytokines and all kinds of stresses. Especially, MAP2K3/MKK3 and MAP2K6/MKK6 are both essential for the activation of MAPK11 and MAPK13 induced by environmental stress, whereas MAP2K6/MKK6 is the major MAPK11 activator in response to TNF. MAP2K6/MKK6 also phosphorylates and activates PAK6. The p38 MAP kinase signal transduction pathway leads to direct activation of transcription factors. Nuclear targets of p38 MAP kinase include the transcription factors ATF2 and ELK1. Within the p38 MAPK signal transduction pathway, MAP3K6/MKK6 mediates phosphorylation of STAT4 through MAPK14 activation, and is therefore required for STAT4 activation and STAT4-regulated gene expression in response to IL-12 stimulation. The pathway is also crucial for IL-6-induced SOCS3 expression and down-regulation of IL-6-mediated gene induction; and for IFNG-dependent gene transcription. Has a role in osteoclast differentiation through NF-kappa-B transactivation by TNFSF11, and in endochondral ossification and since SOX9 is another likely downstream target of the p38 MAPK pathway. MAP2K6/MKK6 mediates apoptotic cell death in thymocytes. Acts also as a regulator for melanocytes dendricity, through the modulation of Rho family GTPases.confidentQ5E9X2
Dual specificity mitogen-activated protein kinase kinase 3 Dual specificity kinase. Is activated by cytokines and environmental stress in vivo. Catalyzes the concomitant phosphorylation of a threonine and a tyrosine residue in the MAP kinase p38.confidentP46734
Dual specificity mitogen-activated protein kinase kinase 6 Dual specificity protein kinase which acts as an essential component of the MAP kinase signal transduction pathway. Catalyzes the concomitant phosphorylation of a threonine and a tyrosine residue in the MAP kinases p38 and plays an important role in the regulation of cellular responses to cytokines and all kinds of stresses. The p38 MAP kinase signal transduction pathway leads to direct activation of transcription factors. Phosphorylation by MAP2K6 asymmetrically activates p38 on one side of the blastodisc, an event which is necessary for blastomere cleavage.confidentQ9DGE0

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0045893 [BP]positive regulation of transcription, DNA-dependentprobableGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0009891, GO:2000112, GO:0019219, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0051171, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0010556, GO:0048522
GO:0042035 [BP]regulation of cytokine biosynthetic processprobableGO:0009889, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051246, GO:0050794, GO:0001817, GO:0010556, GO:0065007, GO:0051239, GO:0008150, GO:0050789
GO:0008063 [BP]Toll signaling pathwayprobableGO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007154, GO:0050789, GO:0044699
GO:0004713 [MF]protein tyrosine kinase activityprobableGO:0016773, GO:0016772, GO:0016301, GO:0003824, GO:0016740, GO:0003674, GO:0004672
GO:0042692 [BP]muscle cell differentiationprobableGO:0032502, GO:0048856, GO:0048869, GO:0030154, GO:0044767, GO:0044763, GO:0061061, GO:0008150, GO:0009987, GO:0044699
GO:0005654 [CC]nucleoplasmprobableGO:0005575, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0002385 [BP]mucosal immune responseprobableGO:0002376, GO:0008150, GO:0050896, GO:0002251, GO:0006955
GO:0007050 [BP]cell cycle arrestprobableGO:0044699, GO:0045786, GO:0051726, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0022402, GO:0048523, GO:0048519, GO:0044763, GO:0050789, GO:0007049
GO:0043204 [CC]perikaryonprobableGO:0044464, GO:0044297, GO:0005623, GO:0005575, GO:0097458, GO:0043025
GO:0034130 [BP]toll-like receptor 1 signaling pathwayprobableGO:0048584, GO:0048583, GO:0031349, GO:0023052, GO:0007165, GO:0050789, GO:0031347, GO:0051716, GO:0002764, GO:0002684, GO:0002682, GO:0044699, GO:0002224, GO:0065007, GO:0002221, GO:0045089, GO:0045088, GO:0009987, GO:0050794, GO:0048518, GO:0050776, GO:0008150, GO:0007154, GO:0044700, GO:0002757, GO:0080134, GO:0002758, GO:0050778, GO:0002376, GO:0002218, GO:0002253, GO:0044763, GO:0050896
GO:0006975 [BP]DNA damage induced protein phosphorylationprobableGO:0016310, GO:0044699, GO:0044267, GO:0051716, GO:0044260, GO:0071704, GO:0006468, GO:0009987, GO:0006464, GO:0006974, GO:0043412, GO:0036211, GO:0044763, GO:0008152, GO:0044238, GO:0019538, GO:0050896, GO:0006950, GO:0044237, GO:0043170, GO:0006796, GO:0033554, GO:0006793, GO:0008150
GO:0043065 [BP]positive regulation of apoptotic processprobableGO:0050794, GO:0050789, GO:0048518, GO:0043067, GO:0065007, GO:0010942, GO:0008150, GO:0010941, GO:0042981, GO:0043068, GO:0048522
GO:0045087 [BP]innate immune responseprobableGO:0002376, GO:0050896, GO:0006952, GO:0006950, GO:0008150, GO:0006955
GO:0040018 [BP]positive regulation of multicellular organism growthprobableGO:0040014, GO:0051240, GO:0050789, GO:0065007, GO:0051239, GO:0048518, GO:0008150, GO:0040008, GO:0045927
GO:0048082 [BP]regulation of adult chitin-containing cuticle pigmentationprobableGO:0048079, GO:0007564, GO:0048070, GO:0008150, GO:0050793, GO:2000026, GO:0051239, GO:0065007, GO:0050789
GO:0042493 [BP]response to drugprobableGO:0042221, GO:0050896, GO:0008150
GO:0051149 [BP]positive regulation of muscle cell differentiationprobableGO:0051094, GO:0050793, GO:0050794, GO:0045597, GO:0045595, GO:0065007, GO:0051147, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0031435 [MF]mitogen-activated protein kinase kinase kinase bindingprobableGO:0019899, GO:0019901, GO:0019900, GO:0003674, GO:0005488, GO:0005515
GO:0004674 [MF]protein serine/threonine kinase activityprobableGO:0016773, GO:0016772, GO:0016301, GO:0003824, GO:0016740, GO:0003674, GO:0004672
GO:0007257 [BP]activation of JUN kinase activityprobableGO:0000187, GO:0080135, GO:0019220, GO:0009893, GO:0019222, GO:0033674, GO:0051246, GO:0031325, GO:0048584, GO:0048583, GO:0032147, GO:0051247, GO:0023056, GO:0043406, GO:0043405, GO:0051174, GO:0007165, GO:0046328, GO:0043506, GO:0071902, GO:0035556, GO:0071900, GO:0010627, GO:0010647, GO:0043085, GO:0043408, GO:0007254, GO:0010646, GO:0051347, GO:0010604, GO:0009966, GO:0009967, GO:0010562, GO:0043549, GO:0000165, GO:0031098, GO:0050789, GO:0023051, GO:0060255, GO:0032268, GO:0032270, GO:0044699, GO:0044093, GO:0031399, GO:0048518, GO:0065007, GO:0065009, GO:0010740, GO:0042325, GO:0050790, GO:0045937, GO:0044700, GO:0070302, GO:0031323, GO:0045859, GO:0080090, GO:0051716, GO:0050794, GO:0032872, GO:0006950, GO:0051403, GO:0044763, GO:0023052, GO:0007154, GO:0043507, GO:0043410, GO:0042327, GO:0001932, GO:0007243, GO:0050896, GO:0031401, GO:0051338, GO:0080134, GO:0033554, GO:0008150, GO:0009987, GO:0045860, GO:0001934, GO:0048522
GO:0007179 [BP]transforming growth factor beta receptor signaling pathwayprobableGO:0007166, GO:0023052, GO:0007165, GO:0070887, GO:0007167, GO:0050789, GO:0044699, GO:0009719, GO:0051716, GO:0070848, GO:0071310, GO:0065007, GO:0071559, GO:0071495, GO:0009987, GO:0050794, GO:0042221, GO:0044763, GO:0007154, GO:0010033, GO:0007178, GO:0044700, GO:0071363, GO:0050896, GO:0071560, GO:0008150
GO:0005524 [MF]ATP bindingprobableGO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0005856 [CC]cytoskeletonprobableGO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0006954 [BP]inflammatory responseprobableGO:0006952, GO:0050896, GO:0006950, GO:0008150, GO:0009611
GO:0006351 [BP]transcription, DNA-dependentprobableGO:0032774, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901362, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0010467, GO:0018130, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0046483, GO:0016070, GO:0044238, GO:0044271, GO:0044237, GO:0043170, GO:0019438
GO:0008545 [MF]JUN kinase kinase activityprobableGO:0016773, GO:0016772, GO:0016301, GO:0003824, GO:0016740, GO:0004712, GO:0004672, GO:0003674, GO:0004708
GO:0060048 [BP]cardiac muscle contractionprobableGO:0032501, GO:0044707, GO:0006936, GO:0008015, GO:0006941, GO:0003012, GO:0060047, GO:0008150, GO:0003015, GO:0003013, GO:0044699, GO:0003008
GO:0002755 [BP]MyD88-dependent toll-like receptor signaling pathwayprobableGO:0048584, GO:0048583, GO:0031349, GO:0023052, GO:0007165, GO:0050789, GO:0031347, GO:0051716, GO:0002764, GO:0002684, GO:0002682, GO:0044699, GO:0002224, GO:0065007, GO:0002221, GO:0045089, GO:0045088, GO:0009987, GO:0050794, GO:0048518, GO:0050776, GO:0008150, GO:0007154, GO:0044700, GO:0002757, GO:0080134, GO:0002758, GO:0050778, GO:0002376, GO:0002218, GO:0002253, GO:0044763, GO:0050896
GO:0034138 [BP]toll-like receptor 3 signaling pathwayprobableGO:0048584, GO:0048583, GO:0031349, GO:0023052, GO:0007165, GO:0050789, GO:0031347, GO:0051716, GO:0002764, GO:0002684, GO:0002682, GO:0044699, GO:0002224, GO:0065007, GO:0002221, GO:0045089, GO:0045088, GO:0009987, GO:0050794, GO:0048518, GO:0050776, GO:0008150, GO:0007154, GO:0044700, GO:0002757, GO:0080134, GO:0002758, GO:0050778, GO:0002376, GO:0002218, GO:0002253, GO:0044763, GO:0050896
GO:0034134 [BP]toll-like receptor 2 signaling pathwayprobableGO:0048584, GO:0048583, GO:0031349, GO:0023052, GO:0007165, GO:0050789, GO:0031347, GO:0051716, GO:0002764, GO:0002684, GO:0002682, GO:0044699, GO:0002224, GO:0065007, GO:0002221, GO:0045089, GO:0045088, GO:0009987, GO:0050794, GO:0048518, GO:0050776, GO:0008150, GO:0007154, GO:0044700, GO:0002757, GO:0080134, GO:0002758, GO:0050778, GO:0002376, GO:0002218, GO:0002253, GO:0044763, GO:0050896
GO:0006915 [BP]apoptotic processprobableGO:0010259, GO:0009987, GO:0012501, GO:0044763, GO:0008150, GO:0007569, GO:0044699
GO:0035666 [BP]TRIF-dependent toll-like receptor signaling pathwayprobableGO:0048584, GO:0048583, GO:0031349, GO:0023052, GO:0007165, GO:0050789, GO:0031347, GO:0051716, GO:0002764, GO:0002684, GO:0002682, GO:0044699, GO:0002224, GO:0065007, GO:0002221, GO:0045089, GO:0045088, GO:0009987, GO:0050794, GO:0048518, GO:0050776, GO:0008150, GO:0007154, GO:0044700, GO:0002756, GO:0002757, GO:0080134, GO:0002758, GO:0050778, GO:0002376, GO:0002218, GO:0002253, GO:0044763, GO:0050896
GO:0032839 [CC]dendrite cytoplasmprobableGO:0005737, GO:0032838, GO:0044463, GO:0044464, GO:0030425, GO:0005622, GO:0005575, GO:0097458, GO:0044444, GO:0005623, GO:0043005, GO:0044424, GO:0042995
GO:0070423 [BP]nucleotide-binding oligomerization domain containing signaling pathwayprobableGO:0048584, GO:0048583, GO:0031349, GO:0023052, GO:0007165, GO:0035556, GO:0050789, GO:0044699, GO:0051716, GO:0030522, GO:0002764, GO:0035872, GO:0002684, GO:0065007, GO:0031347, GO:0048518, GO:0002682, GO:0002221, GO:0045089, GO:0045088, GO:0009987, GO:0050794, GO:0050776, GO:0044763, GO:0007154, GO:0044700, GO:0002757, GO:0002753, GO:0050896, GO:0002758, GO:0050778, GO:0002376, GO:0002218, GO:0002253, GO:0008150, GO:0080134
GO:0034142 [BP]toll-like receptor 4 signaling pathwayprobableGO:0048584, GO:0048583, GO:0031349, GO:0023052, GO:0007165, GO:0050789, GO:0031347, GO:0051716, GO:0002764, GO:0002684, GO:0002682, GO:0044699, GO:0002224, GO:0065007, GO:0002221, GO:0045089, GO:0045088, GO:0009987, GO:0050794, GO:0048518, GO:0050776, GO:0008150, GO:0007154, GO:0044700, GO:0002757, GO:0080134, GO:0002758, GO:0050778, GO:0002376, GO:0002218, GO:0002253, GO:0044763, GO:0050896
GO:0033267 [CC]axon partprobableGO:0044463, GO:0044464, GO:0005623, GO:0030424, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0007309 [BP]oocyte axis specificationprobableGO:0048610, GO:0009994, GO:0030154, GO:0048468, GO:0007569, GO:0007292, GO:0007308, GO:0009798, GO:0010259, GO:0007275, GO:0044699, GO:0007389, GO:0000003, GO:0048869, GO:0007276, GO:0048477, GO:0032502, GO:0048599, GO:0032501, GO:0048609, GO:0032504, GO:0009987, GO:0019953, GO:0007281, GO:0022414, GO:0008150, GO:0022412, GO:0044767, GO:0044702, GO:0044707, GO:0003006, GO:0048856, GO:0044763

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3FME, chain A
Confidence level:very confident
Coverage over the Query: 11-86
View the alignment between query and template
View the model in PyMOL