Diaphorina citri psyllid: psy1329


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-----
MSKIFTPTNQIRMTNVAIVRMKKAGKRFEIACYKNKVISWRNNIEKDIDEVLQTHTVFTNVSKGQAANKEDLKKAFNTEDQTEICKLILMKDMSKIFTPTNQIRMTNVAIVRMKKAGKRFEIACYKNKVISWRNNIEKDIDEVLQTHTVFTNVSKGQAANKEDLKKAFNTNMLNISSLTSFREKDIDEVLQTHTVFTNVSKGQAANKEDLKKAFNTEDQTEICKLILMKGELQISDKERSSQIENQFKDIATIVSEKCINTETKRPFTVSMIEAGLKQIHFSVNVNKNSKQQALEVIPTLKQCMSIERAQMRVRVEVSAGVKDVKKLKEKLVKCATSVENEEWSGGGLLLICLIDPGKYREIDELVRTETRGQGTLELLNLKEVTEGEEERSSQIENQFKDIATIVSEKCINTETKRPFTVSMIEAGLKQIHFSVNVNKNSKQQALEEDKTSGIYSSLYKACKFS
ccccccccccEEEcEEEEEEEEEccEEEEEEEEcHHHHHHHHcccccHHHHHHcccccccccccccccHHHHHHHHccccHHHHHHHHHHccccccccccccHHHHHHHHHHHHHccEEEEEEEEccccHHHHccccccHHHHHHcccEEEcccccccccHHHHHHHHccccccccccccccccccHHHHHHccccccccccccccHHHHHHHHccccHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHcccEEccccccHHHHHHHHHHHHHHHccccEEEEEEEEEEccccHHHHHHHHHHHHHcccEEEEEECccCEEEEEEEccccHHHHHHHHHHHccccEEEEEccccccccccHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHccccccccccHHHHHHHHHHHcccccccccccccc
*******TNQIRMTNVAIVRMKKAGKRFEIACYKNKVISWRNNIEKDIDEVLQTHTVFTNVSKGQAANKEDLKKAFNTEDQTEICKLILMKDMSKIFTPTNQIRMTNVAIVRMKKAGKRFEIACYKNKVISWRNNIEKDIDEVLQTHTVFTNVSKGQAANKEDLKKAFNTNMLNISSLTSFREKDIDEVLQTHTVFTNVSKGQAANKEDLKKAFNTEDQTEICKLILMKGELQ***********NQFKDIATIVSEKCINTETKRPFTVSMIEAGLKQIHFSVNVNKNSKQQALEVIPTLKQCMSIERAQMRVRVEVSAGVKDVKKLKEKLVKCATSVENEEWSGGGLLLICLIDPGKYREIDELVRTETRGQGTLELLNL*****************FKDIATIVSEKCINTETKRPFTVSMIEAGLKQIHFSVNVNKNSKQQALEEDKTSGIYSSLYKACKF*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSKIFTPTNQIRMTNVAIVRMKKAGKRFEIACYKNKVISWRNNIEKDIDEVLQTHTVFTNVSKGQAANKEDLKKAFNTEDQTEICKLILMKDMSKIFTPTNQIRMTNVAIVRMKKAGKRFEIACYKNKVISWRNNIEKDIDEVLQTHTVFTNVSKGQAANKEDLKKAFNTNMLNISSLTSFREKDIDEVLQTHTVFTNVSKGQAANKEDLKKAFNTEDQTEICKLILMKGELQISDKERSSQIENQFKDIATIVSEKCINTETKRPFTVSMIEAGLKQIHFSVNVNKNSKQQALEVIPTLKQCMSIERAQMRVRVEVSAGVKDVKKLKEKLVKCATSVENEEWSGGGLLLICLIDPGKYREIDELVRTETRGQGTLELLNLKEVTEGEEERSSQIENQFKDIATIVSEKCINTETKRPFTVSMIEAGLKQIHFSVNVNKNSKQQALEEDKTSGIYSSLYKACKFS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ribosome maturation protein SBDS Required for the assembly of mature ribosomes and ribosome biogenesis. Together with EFTUD1, triggers the GTP-dependent release of EIF6 from 60S pre-ribosomes in the cytoplasm, thereby activating ribosomes for translation competence by allowing 80S ribosome assembly and facilitating EIF6 recycling to the nucleus, where it is required for 60S rRNA processing and nuclear export. Required for normal levels of protein synthesis. May play a role in cellular stress resistance. May play a role in cellular response to DNA damage. May play a role in cell proliferation.confidentQ3SWZ6
Ribosome maturation protein SBDS Required for the assembly of mature ribosomes and ribosome biogenesis. Together with EFTUD1, triggers the GTP-dependent release of EIF6 from 60S pre-ribosomes in the cytoplasm, thereby activating ribosomes for translation competence by allowing 80S ribosome assembly and facilitating EIF6 recycling to the nucleus, where it is required for 60S rRNA processing and nuclear export. Required for normal levels of protein synthesis. May play a role in cellular stress resistance. May play a role in cellular response to DNA damage. May play a role in cell proliferation.confidentQ5RK30
Ribosome maturation protein SBDS Required for the assembly of mature ribosomes and ribosome biogenesis. Together with EFTUD1, triggers the GTP-dependent release of EIF6 from 60S pre-ribosomes in the cytoplasm, thereby activating ribosomes for translation competence by allowing 80S ribosome assembly and facilitating EIF6 recycling to the nucleus, where it is required for 60S rRNA processing and nuclear export. Required for normal levels of protein synthesis. May play a role in cellular stress resistance. May play a role in cellular response to DNA damage. May play a role in cell proliferation.confidentQ5ZIY4

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0000922 [CC]spindle poleprobableGO:0043234, GO:0005856, GO:0005819, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044422, GO:0044424, GO:0043228, GO:0043226, GO:0015630
GO:0030595 [BP]leukocyte chemotaxisprobableGO:0040011, GO:0051716, GO:0006935, GO:0042330, GO:0048870, GO:0050896, GO:0009987, GO:0044763, GO:0006928, GO:0002376, GO:0050900, GO:0051674, GO:0008150, GO:0070887, GO:0060326, GO:0042221, GO:0051179, GO:0016477, GO:0009605, GO:0044699
GO:0043022 [MF]ribosome bindingprobableGO:0043021, GO:0003674, GO:0005488
GO:0042256 [BP]mature ribosome assemblyprobableGO:0006996, GO:0071826, GO:0022607, GO:0043933, GO:0009987, GO:0042255, GO:0042254, GO:0016043, GO:0065003, GO:0022618, GO:0044763, GO:0071840, GO:0034622, GO:0022613, GO:0008150, GO:0070925, GO:0044699, GO:0044085
GO:0043148 [BP]mitotic spindle stabilizationprobableGO:0031110, GO:0031111, GO:0090224, GO:0031114, GO:0033043, GO:0010564, GO:1901879, GO:0051129, GO:0051128, GO:0022402, GO:0043244, GO:0032886, GO:0050789, GO:0044699, GO:0043242, GO:0007346, GO:0007026, GO:0051494, GO:0051493, GO:0043146, GO:0065007, GO:0007049, GO:0048519, GO:0009987, GO:0060236, GO:1901880, GO:0008150, GO:0050794, GO:0051726, GO:0010639, GO:0044763, GO:0070507, GO:0048523
GO:0008017 [MF]microtubule bindingprobableGO:0015631, GO:0003674, GO:0005488, GO:0005515, GO:0008092
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0008283 [BP]cell proliferationprobableGO:0008150, GO:0044699
GO:0030282 [BP]bone mineralizationprobableGO:0001503, GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0009888, GO:0048513, GO:0008150, GO:0031214, GO:0048731, GO:0007275, GO:0044699
GO:0048539 [BP]bone marrow developmentprobableGO:0032502, GO:0002376, GO:0032501, GO:0044707, GO:0048856, GO:0060348, GO:0044767, GO:0001501, GO:0048513, GO:0008150, GO:0048731, GO:0048534, GO:0007275, GO:0044699, GO:0002520
GO:0019843 [MF]rRNA bindingprobableGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:1901363, GO:0003723

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2KDO, chain A
Confidence level:very confident
Coverage over the Query: 92-156,203-390
View the alignment between query and template
View the model in PyMOL
Template: 2KDO, chain A
Confidence level:very confident
Coverage over the Query: 1-102,114-120,132-176
View the alignment between query and template
View the model in PyMOL
Template: 2L9N, chain A
Confidence level:very confident
Coverage over the Query: 96-137,184-389
View the alignment between query and template
View the model in PyMOL
Template: 2L9N, chain A
Confidence level:probable
Coverage over the Query: 96-137,184-389
View the alignment between query and template
View the model in PyMOL