Diaphorina citri psyllid: psy13307


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280------
MRWLTAVQDEPIKHELYAKQLSFIPETADFLIGCILFFFFFSSREDIEFMLACCETNHDGKIDYVGFTDRFHEPAKEIGFNLAVLLTNLSEHMPNEPRLARFLETASSVLNYFHPFLGRIEILGGSKRIERVYFEIKESNIEQWEKPQIKESKRAFFYSIVTEGGDKEKLEAFVNFCEDAIFEMQHASGLMAVEEGGGAGSGKARKQAYNYLSVDGEEEKNINPIRRGWQGFKDGIRFTLSMLSPSNIKQKINEMQQMSIPQLVVGFFKLFFYAFYYSNYSVYLVL
ccccccccccccHHHHHHHHcccccccccHHHEHHHHccccccHHHHHHHHHHHcccccccccHHHHHHHHccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHccccccEEEEEcccccEEEEEEEcccccHHHccccccHHcHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHEEEEEc
**WLTAVQDEPIKHELYAKQLSFIPETADFLIGCILFFFFFSSREDIEFMLACCETNHDGKIDYVGFTDRFHEPAKEIGFNLAVLLTNLSEHMPNEPRLARFLETASSVLNYFHPFLGRIEILGGSKRIERVYFEIKESNIEQWEKPQIKESKRAFFYSIVTEGGDKEKLEAFVNFCEDAIFEMQHASGL*******************************INPIRRGWQGFKDGIRFTLSMLSPSNIKQKINEMQQMSIPQLVVGFFKLFFYAFYYSNYSVYLVL
xxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRWLTAVQDEPIKHELYAKQLSFIPETADFLIGCILFFFFFSSREDIEFMLACCETNHDGKIDYVGFTDRFHEPAKEIGFNLAVLLTNLSEHMPNEPRLARFLETASSVLNYFHPFLGRIEILGGSKRIERVYFEIKESNIEQWEKPQIKESKRAFFYSIVTEGGDKEKLEAFVNFCEDAIFEMQHASGLMAVEEGGGAGSGKARKQAYNYLSVDGEEEKNINPIRRGWQGFKDGIRFTLSMLSPSNIKQKINEMQQMSIPQLVVGFFKLFFYAFYYSNYSVYLVL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ryanodine receptor 44F Intracellular calcium channel that is required for proper muscle function during embryonic development and may be essential for excitation-contraction coupling in larval body wall muscles.confidentQ24498
Ryanodine receptor 2 Calcium channel that mediates the release of Ca(2+) from the sarcoplasmic reticulum into the cytoplasm and thereby plays a key role in triggering cardiac muscle contraction. Aberrant channel activation can lead to cardiac arrhythmia. In cardiac myocytes, calcium release is triggered by increased Ca(2+) levels due to activation of the L-type calcium channel CACNA1C. The calcium channel activity is modulated by formation of heterotetramers with RYR3. Required for cellular calcium ion homeostasis. Required for embryonic heart development.confidentE9Q401

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005875 [CC]microtubule associated complexprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0051716 [BP]cellular response to stimulusprobableGO:0008150, GO:0050896, GO:0009987, GO:0044763, GO:0044699
GO:0070296 [BP]sarcoplasmic reticulum calcium ion transportprobableGO:0009987, GO:0072511, GO:0046907, GO:0006812, GO:0006811, GO:0006810, GO:0044763, GO:0006816, GO:0008150, GO:0044765, GO:0030001, GO:0051649, GO:0070838, GO:0051234, GO:0051179, GO:0044699, GO:0051641
GO:0051592 [BP]response to calcium ionprobableGO:0042221, GO:0050896, GO:0010035, GO:0008150, GO:0010038
GO:0030314 [CC]junctional membrane complexprobableGO:0043234, GO:0005737, GO:0032991, GO:0044464, GO:0044444, GO:0005623, GO:0005622, GO:0005575, GO:0016528, GO:0044424
GO:0016021 [CC]integral to membraneprobableGO:0005575, GO:0044425, GO:0016020, GO:0031224
GO:0006936 [BP]muscle contractionprobableGO:0032501, GO:0044707, GO:0003012, GO:0008150, GO:0044699, GO:0003008
GO:0001666 [BP]response to hypoxiaprobableGO:0009628, GO:0036293, GO:0050896, GO:0006950, GO:0008150, GO:0070482
GO:0014802 [CC]terminal cisternaprobableGO:0005737, GO:0005575, GO:0031984, GO:0005783, GO:0043229, GO:0044464, GO:0044444, GO:0005623, GO:0005622, GO:0044446, GO:0044432, GO:0016528, GO:0016529, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0031000 [BP]response to caffeineprobableGO:0009719, GO:0050896, GO:1901698, GO:0010033, GO:0008150, GO:0042221, GO:0043279, GO:0014074, GO:0010243, GO:0014070
GO:0005219 [MF]ryanodine-sensitive calcium-release channel activityprobableGO:0005261, GO:0005262, GO:0003674, GO:0015085, GO:0015278, GO:0015276, GO:0072509, GO:0022803, GO:0046873, GO:0008324, GO:0005218, GO:0005215, GO:0005216, GO:0005217, GO:0022891, GO:0022890, GO:0022892, GO:0015075, GO:0022857, GO:0015267, GO:0022836, GO:0022834, GO:0022839, GO:0022838
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0035206 [BP]regulation of hemocyte proliferationprobableGO:0042127, GO:0050793, GO:0050794, GO:0008150, GO:0002682, GO:0051239, GO:0065007, GO:0050789
GO:0060402 [BP]calcium ion transport into cytosolprobableGO:0050801, GO:0051649, GO:0042592, GO:0055074, GO:0044699, GO:0072507, GO:0072503, GO:0065007, GO:0006812, GO:0016482, GO:0019725, GO:0009987, GO:0060401, GO:0006875, GO:0006874, GO:0006811, GO:0006810, GO:0006816, GO:0006873, GO:0044765, GO:0008150, GO:0030003, GO:0055065, GO:0055080, GO:0072511, GO:0055082, GO:0051234, GO:0051179, GO:0051641, GO:0065008, GO:0070838, GO:0046907, GO:0051480, GO:0044763, GO:0007204, GO:0048878, GO:0030001
GO:0031674 [CC]I bandprobableGO:0005737, GO:0005575, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0030016, GO:0030017, GO:0044444, GO:0043228, GO:0043292, GO:0044424, GO:0043226, GO:0044422, GO:0044449
GO:0005938 [CC]cell cortexprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0071944, GO:0044424
GO:0051282 [BP]regulation of sequestering of calcium ionprobableGO:0032844, GO:2000021, GO:0065007, GO:0008150, GO:0032879, GO:0050789, GO:0050794
GO:0070588 [BP]calcium ion transmembrane transportprobableGO:0009987, GO:0070838, GO:0006812, GO:0006811, GO:0006810, GO:0044763, GO:0006816, GO:0051179, GO:0008150, GO:0034220, GO:0044765, GO:0030001, GO:0072511, GO:0051234, GO:0055085, GO:0044699
GO:0033017 [CC]sarcoplasmic reticulum membraneprobableGO:0005783, GO:0005789, GO:0042175, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0044446, GO:0031090, GO:0016020, GO:0016528, GO:0044432, GO:0012505, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0016529, GO:0044424, GO:0044425, GO:0044422
GO:0005245 [MF]voltage-gated calcium channel activityprobableGO:0005261, GO:0005262, GO:0003674, GO:0015085, GO:0072509, GO:0022843, GO:0022803, GO:0046873, GO:0005215, GO:0005216, GO:0008324, GO:0022891, GO:0022890, GO:0022892, GO:0005244, GO:0015075, GO:0022832, GO:0022857, GO:0015267, GO:0022836, GO:0022839, GO:0022838
GO:0030315 [CC]T-tubuleprobableGO:0042383, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1WY9, chain A
Confidence level:probable
Coverage over the Query: 41-86
View the alignment between query and template
View the model in PyMOL