Psyllid ID: psy13307

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280------
MRWLTAVQDEPIKHELYAKQLSFIPETADFLIGCILFFFFFSSREDIEFMLACCETNHDGKIDYVGFTDRFHEPAKEIGFNLAVLLTNLSEHMPNEPRLARFLETASSVLNYFHPFLGRIEILGGSKRIERVYFEIKESNIEQWEKPQIKESKRAFFYSIVTEGGDKEKLEAFVNFCEDAIFEMQHASGLMAVEEGGGAGSGKARKQAYNYLSVDGEEEKNINPIRRGWQGFKDGIRFTLSMLSPSNIKQKINEMQQMSIPQLVVGFFKLFFYAFYYSNYSVYLVL
ccccccccccccHHHHHHHHcccccccccHHHEHHHHccccccHHHHHHHHHHHcccccccccHHHHHHHHccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHccccccEEEEEcccccEEEEEEEccccHHHHHccccHHHcHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHEEEEEc
ccEEEEccccccHHHHHHHHHccccHHHHHHHHcHHEEEEEccHHHHHHHHHHHcccccccccHHHHHHHHccHHHHHcHHHHHHHHcHHccccccHHHHHHHHHHHHHHHHHcHHccEEEEEcccccEEEEEEEEEcccHHHcccccccHcHHHHHEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHEEEc
mrwltavqdepikhELYAkqlsfipetADFLIGCILFFFFFSSREDIEFMLACCetnhdgkidyvgftdrfhepakeIGFNLAVLLTNlsehmpneprLARFLETASSVLNYFHPFLGRIEILGGSKRIERVYFEIKESnieqwekpqikeskRAFFYSIVTEGGDKEKLEAFVNFCEDAIFEMQHASglmaveegggagsgkarKQAYNYLsvdgeeekninpirrgwqgfkDGIRFtlsmlspsniKQKINEMQQMSIPQLVVGFFKLFFYAFYYSNYSVYLVL
mrwltavqdepikhELYAKQLSFIPETADFLIGCILFFFFFSSREDIEFMLACCETNHDGKIDYVGFTDRFHEPAKEIGFNLAVLLTNLSEHMPNEPRLARFLETASSVLNYFHPFLGRIEILGGSKRIERVYFEIKesnieqwekpqikeskrAFFYSIVTEGGDKEKLEAFVNFCEDAIFEMQHASGLMAVEEGGGAGSGKARKQAYNYLSvdgeeekninpirrgwQGFKDGIRFTLSMLSPSNIKQKINEMQQMSIPQLVVGFFKLFFYAFYYSNYSVYLVL
MRWLTAVQDEPIKHELYAKQLSFIPETADFLIGCILfffffssREDIEFMLACCETNHDGKIDYVGFTDRFHEPAKEIGFNLAVLLTNLSEHMPNEPRLARFLETASSVLNYFHPFLGRIEILGGSKRIERVYFEIKESNIEQWEKPQIKESKRAFFYSIVTEGGDKEKLEAFVNFCEDAIFEMQHASGLMAVEEGGGAGSGKARKQAYNYLSVDGEEEKNINPIRRGWQGFKDGIRFTLSMLSPSNIKQKINEMQQMSIPQLVVGFFKLFFYAFYYSNYSVYLVL
***LTAVQDEPIKHELYAKQLSFIPETADFLIGCILFFFFFSSREDIEFMLACCETNHDGKIDYVGFTDRFHEPAKEIGFNLAVLLTNLSEHMPNEPRLARFLETASSVLNYFHPFLGRIEILGGSKRIERVYFEIKESNIEQWEKPQIKESKRAFFYSIVTEGGDKEKLEAFVNFCEDAIFEMQHASGLMAV***************YNYLSVD****KNINPIRRGWQGFKDGIRFTLSMLSPSNIKQKINEMQQMSIPQLVVGFFKLFFYAFYYSNYSVYLV*
**WLT**QDEPIKHELYAKQLSFIPETADFLIGCILFFFFFSSREDIEFMLACCETNHDGKIDYVGFTDRFHEPAKEIGFNLAVLLTNLSEHMPNEPRLARFLETASSVLNYFHPFLGRIEILGGSKRIERVYFEIKESNIEQWEKPQIKESKRAFFYSIVTEGGDKEKLEAFVNFCEDAIFEMQ*****************************************RGWQGFKDGIRFTLSMLSPSNIKQKINEMQQMSIPQLVVGFFKLFFYAFYYSNYSVYLVL
MRWLTAVQDEPIKHELYAKQLSFIPETADFLIGCILFFFFFSSREDIEFMLACCETNHDGKIDYVGFTDRFHEPAKEIGFNLAVLLTNLSEHMPNEPRLARFLETASSVLNYFHPFLGRIEILGGSKRIERVYFEIKESNIEQWEKPQIKESKRAFFYSIVTEGGDKEKLEAFVNFCEDAIFEMQHASGLMAVEE*********RKQAYNYLSVDGEEEKNINPIRRGWQGFKDGIRFTLSMLSPSNIKQKINEMQQMSIPQLVVGFFKLFFYAFYYSNYSVYLVL
*RWLTAVQDEPIKHELYAKQLSFIPETADFLIGCILFFFFFSSREDIEFMLACCETNHDGKIDYVGFTDRFHEPAKEIGFNLAVLLTNLSEHMPNEPRLARFLETASSVLNYFHPFLGRIEILGGSKRIERVYFEIKESNIEQWEKPQIKESKRAFFYSIVTEGGDKEKLEAFVNFCEDAIFEMQHASGL*******************************INPIRRGWQGFKDGIRFTLSMLSPSNIKQKINEMQQMSIPQLVVGFFKLFFYAFYYSNYSVYLVL
oooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHo
iiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHi
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooo
oooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRWLTAVQDEPIKHELYAKQLSFIPETADFLIGCILFFFFFSSREDIEFMLACCETNHDGKIDYVGFTDRFHEPAKEIGFNLAVLLTNLSEHMPNEPRLARFLETASSVLNYFHPFLGRIEILGGSKRIERVYFEIKESNIEQWEKPQIKESKRAFFYSIVTEGGDKEKLEAFVNFCEDAIFEMQHASGLMAVEEGGGAGSGKARKQAYNYLSVDGEEEKNINPIRRGWQGFKDGIRFTLSMLSPSNIKQKINEMQQMSIPQLVVGFFKLFFYAFYYSNYSVYLVL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query286 2.2.26 [Sep-21-2011]
Q24498 5127 Ryanodine receptor 44F OS yes N/A 0.835 0.046 0.711 7e-98
Q9TS33 4872 Ryanodine receptor 3 OS=O yes N/A 0.814 0.047 0.466 2e-58
Q15413 4870 Ryanodine receptor 3 OS=H yes N/A 0.814 0.047 0.466 4e-57
B0LPN4 4953 Ryanodine receptor 2 OS=R no N/A 0.510 0.029 0.678 3e-55
E9Q401 4966 Ryanodine receptor 2 OS=M yes N/A 0.510 0.029 0.678 3e-55
Q92736 4967 Ryanodine receptor 2 OS=H no N/A 0.510 0.029 0.678 3e-55
P30957 4969 Ryanodine receptor 2 OS=O no N/A 0.510 0.029 0.678 4e-55
A2AGL3 4863 Ryanodine receptor 3 OS=M no N/A 0.510 0.030 0.650 5e-54
P16960 5035 Ryanodine receptor 1 OS=S no N/A 0.5 0.028 0.615 2e-49
P11716 5037 Ryanodine receptor 1 OS=O no N/A 0.5 0.028 0.608 3e-49
>sp|Q24498|RY44_DROME Ryanodine receptor 44F OS=Drosophila melanogaster GN=Rya-r44F PE=1 SV=3 Back     alignment and function desciption
 Score =  357 bits (915), Expect = 7e-98,   Method: Compositional matrix adjust.
 Identities = 173/243 (71%), Positives = 201/243 (82%), Gaps = 4/243 (1%)

Query: 45   EDIEFMLACCETNHDGKIDYVGFTDRFHEPAKEIGFNLAVLLTNLSEHMPNEPRLARFLE 104
            E+++F+LACCE NH+GKIDY  F + FHEP+KEIGFNLAVLLTNLSEHMPNEPRLARFLE
Sbjct: 4236 EEMDFLLACCERNHEGKIDYRAFVEHFHEPSKEIGFNLAVLLTNLSEHMPNEPRLARFLE 4295

Query: 105  TASSVLNYFHPFLGRIEILGGSKRIERVYFEIKESNIEQWEKPQIKESKRAFFYSIVTEG 164
            TA SVLNYF PFLGRIEILG SKRIERVYFEIK+SNIEQWEKPQI+ESKRAFFYSIVTEG
Sbjct: 4296 TAGSVLNYFEPFLGRIEILGSSKRIERVYFEIKDSNIEQWEKPQIRESKRAFFYSIVTEG 4355

Query: 165  GDKEKLEAFVNFCEDAIFEMQHASGLMAVEEGGGAGSGKARKQAY-NYLSVDGEEEKNIN 223
            GDKEKLEAFVNFCEDAIFEM HASGLMA ++GGG      R  AY +Y+S + EE    +
Sbjct: 4356 GDKEKLEAFVNFCEDAIFEMTHASGLMATDDGGG---NVKRDTAYSSYMSEEEEERAARD 4412

Query: 224  PIRRGWQGFKDGIRFTLSMLSPSNIKQKINEMQQMSIPQLVVGFFKLFFYAFYYSNYSVY 283
            PIRR     K+G++F + MLSP+NIK +I  MQ  SIP+L+VGFFK+ FY FYY+ Y+ +
Sbjct: 4413 PIRRTITAVKEGLKFGVHMLSPANIKHQIGVMQTKSIPELIVGFFKIIFYIFYYTGYAHF 4472

Query: 284  LVL 286
             V+
Sbjct: 4473 CVV 4475
Intracellular calcium channel that is required for proper muscle function during embryonic development and may be essential for excitation-contraction coupling in larval body wall muscles.
Drosophila melanogaster (taxid: 7227)
>sp|Q9TS33|RYR3_RABIT Ryanodine receptor 3 OS=Oryctolagus cuniculus PE=1 SV=1 Back     alignment and function description
>sp|Q15413|RYR3_HUMAN Ryanodine receptor 3 OS=Homo sapiens GN=RYR3 PE=1 SV=3 Back     alignment and function description
>sp|B0LPN4|RYR2_RAT Ryanodine receptor 2 OS=Rattus norvegicus GN=Ryr2 PE=1 SV=2 Back     alignment and function description
>sp|E9Q401|RYR2_MOUSE Ryanodine receptor 2 OS=Mus musculus GN=Ryr2 PE=1 SV=1 Back     alignment and function description
>sp|Q92736|RYR2_HUMAN Ryanodine receptor 2 OS=Homo sapiens GN=RYR2 PE=1 SV=3 Back     alignment and function description
>sp|P30957|RYR2_RABIT Ryanodine receptor 2 OS=Oryctolagus cuniculus GN=RYR2 PE=1 SV=3 Back     alignment and function description
>sp|A2AGL3|RYR3_MOUSE Ryanodine receptor 3 OS=Mus musculus GN=Ryr3 PE=1 SV=1 Back     alignment and function description
>sp|P16960|RYR1_PIG Ryanodine receptor 1 OS=Sus scrofa GN=RYR1 PE=2 SV=2 Back     alignment and function description
>sp|P11716|RYR1_RABIT Ryanodine receptor 1 OS=Oryctolagus cuniculus GN=RYR1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query286
389568467 5142 ryanodine receptor [Bemisia tabaci] 0.839 0.046 0.834 1e-111
389568471 5115 ryanodine receptor [Laodelphax striatell 0.846 0.047 0.814 1e-111
270003382 4986 hypothetical protein TcasGA2_TC002610 [T 0.839 0.048 0.769 1e-108
328717378 5101 PREDICTED: ryanodine receptor 44F-like i 0.853 0.047 0.758 1e-106
307197748 5080 Ryanodine receptor 44F [Harpegnathos sal 0.842 0.047 0.745 1e-105
307178710 3132 Ryanodine receptor 44F [Camponotus flori 0.842 0.076 0.75 1e-105
383851977 5084 PREDICTED: ryanodine receptor 44F-like [ 0.842 0.047 0.758 1e-104
4102117 573 ryanodine receptor [Heliothis virescens] 0.842 0.420 0.760 1e-104
328789627 5082 PREDICTED: ryanodine receptor 44F [Apis 0.842 0.047 0.75 1e-103
380026505 5026 PREDICTED: LOW QUALITY PROTEIN: ryanodin 0.842 0.047 0.75 1e-103
>gi|389568467|gb|AFK84957.1| ryanodine receptor [Bemisia tabaci] Back     alignment and taxonomy information
 Score =  408 bits (1048), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 201/241 (83%), Positives = 220/241 (91%), Gaps = 1/241 (0%)

Query: 45   EDIEFMLACCETNHDGKIDYVGFTDRFHEPAKEIGFNLAVLLTNLSEHMPNEPRLARFLE 104
            E+IEFMLACCETNHDGKIDYVGFTDRFHEPAKEIGFNLAVLLTNLSEHMPNEPRLARFLE
Sbjct: 4242 EEIEFMLACCETNHDGKIDYVGFTDRFHEPAKEIGFNLAVLLTNLSEHMPNEPRLARFLE 4301

Query: 105  TASSVLNYFHPFLGRIEILGGSKRIERVYFEIKESNIEQWEKPQIKESKRAFFYSIVTEG 164
            TA SVLNYF PFLGRIEILGGSK+IERVYFEIKESNIEQWEKPQIKESKRAFFYSIVTEG
Sbjct: 4302 TAGSVLNYFEPFLGRIEILGGSKKIERVYFEIKESNIEQWEKPQIKESKRAFFYSIVTEG 4361

Query: 165  GDKEKLEAFVNFCEDAIFEMQHASGLMAVEEGGGAGSGKARKQAYNYLSVDGEEEKNINP 224
            GDKEKLEAFVNFCEDAIFEMQHASGLMAV++G G G GK RK AY+YLS D +EEKN++P
Sbjct: 4362 GDKEKLEAFVNFCEDAIFEMQHASGLMAVDDGSGVGGGKTRKAAYSYLS-DEDEEKNVHP 4420

Query: 225  IRRGWQGFKDGIRFTLSMLSPSNIKQKINEMQQMSIPQLVVGFFKLFFYAFYYSNYSVYL 284
            I+RG Q  KD + F  +MLSPSNIKQK+ E+QQMS+P++V+GFFKL FY FYYS +SV +
Sbjct: 4421 IKRGLQAVKDTVFFLFAMLSPSNIKQKLGELQQMSVPEMVIGFFKLIFYLFYYSGFSVMV 4480

Query: 285  V 285
            V
Sbjct: 4481 V 4481

Source: Bemisia tabaci

Species: Bemisia tabaci

Genus: Bemisia

Family: Aleyrodidae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|389568471|gb|AFK84959.1| ryanodine receptor [Laodelphax striatella] Back     alignment and taxonomy information
>gi|270003382|gb|EEZ99829.1| hypothetical protein TcasGA2_TC002610 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|328717378|ref|XP_003246190.1| PREDICTED: ryanodine receptor 44F-like isoform 1 [Acyrthosiphon pisum] gi|328717380|ref|XP_003246191.1| PREDICTED: ryanodine receptor 44F-like isoform 2 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|307197748|gb|EFN78897.1| Ryanodine receptor 44F [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|307178710|gb|EFN67324.1| Ryanodine receptor 44F [Camponotus floridanus] Back     alignment and taxonomy information
>gi|383851977|ref|XP_003701507.1| PREDICTED: ryanodine receptor 44F-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|4102117|gb|AAD01424.1| ryanodine receptor [Heliothis virescens] Back     alignment and taxonomy information
>gi|328789627|ref|XP_392217.4| PREDICTED: ryanodine receptor 44F [Apis mellifera] Back     alignment and taxonomy information
>gi|380026505|ref|XP_003696991.1| PREDICTED: LOW QUALITY PROTEIN: ryanodine receptor 44F-like [Apis florea] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query286
FB|FBgn0011286 5127 Rya-r44F "Ryanodine receptor 4 0.835 0.046 0.711 1e-88
UNIPROTKB|F1NYM2 4856 RYR3 "Uncharacterized protein" 0.846 0.049 0.453 5.1e-54
UNIPROTKB|F1NCJ4 4861 RYR3 "Uncharacterized protein" 0.846 0.049 0.453 5.1e-54
UNIPROTKB|F1NSR9 4874 RYR3 "Uncharacterized protein" 0.846 0.049 0.453 5.1e-54
UNIPROTKB|J9P355 4632 RYR3 "Uncharacterized protein" 0.811 0.050 0.470 1.3e-53
UNIPROTKB|F1PJL2 4813 RYR3 "Uncharacterized protein" 0.811 0.048 0.470 1.3e-53
UNIPROTKB|Q9TS33 4872 Q9TS33 "Ryanodine receptor 3" 0.846 0.049 0.447 1.7e-53
UNIPROTKB|B4DGV4 1421 RYR2 "Ryanodine receptor 2" [H 0.804 0.161 0.487 1.9e-53
UNIPROTKB|P30957 4969 RYR2 "Ryanodine receptor 2" [O 0.804 0.046 0.487 6e-53
UNIPROTKB|H0YGL9 4951 RYR2 "Ryanodine receptor 2" [H 0.804 0.046 0.487 1.2e-52
FB|FBgn0011286 Rya-r44F "Ryanodine receptor 44F" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 904 (323.3 bits), Expect = 1.0e-88, Sum P(2) = 1.0e-88
 Identities = 173/243 (71%), Positives = 201/243 (82%)

Query:    45 EDIEFMLACCETNHDGKIDYVGFTDRFHEPAKEIGFNLAVLLTNLSEHMPNEPRLARFLE 104
             E+++F+LACCE NH+GKIDY  F + FHEP+KEIGFNLAVLLTNLSEHMPNEPRLARFLE
Sbjct:  4236 EEMDFLLACCERNHEGKIDYRAFVEHFHEPSKEIGFNLAVLLTNLSEHMPNEPRLARFLE 4295

Query:   105 TASSVLNYFHPFLGRIEILGGSKRIERVYFEIKESNIEQWEKPQIKESKRAFFYSIVTEG 164
             TA SVLNYF PFLGRIEILG SKRIERVYFEIK+SNIEQWEKPQI+ESKRAFFYSIVTEG
Sbjct:  4296 TAGSVLNYFEPFLGRIEILGSSKRIERVYFEIKDSNIEQWEKPQIRESKRAFFYSIVTEG 4355

Query:   165 GDKEKLEAFVNFCEDAIFEMQHASGLMAVEEGGGAGSGKARKQAYN-YLSVDGEEEKNIN 223
             GDKEKLEAFVNFCEDAIFEM HASGLMA ++GGG      R  AY+ Y+S + EE    +
Sbjct:  4356 GDKEKLEAFVNFCEDAIFEMTHASGLMATDDGGG---NVKRDTAYSSYMSEEEEERAARD 4412

Query:   224 PIRRGWQGFKDGIRFTLSMLSPSNIKQKINEMQQMSIPQLVVGFFKLFFYAFYYSNYSVY 283
             PIRR     K+G++F + MLSP+NIK +I  MQ  SIP+L+VGFFK+ FY FYY+ Y+ +
Sbjct:  4413 PIRRTITAVKEGLKFGVHMLSPANIKHQIGVMQTKSIPELIVGFFKIIFYIFYYTGYAHF 4472

Query:   284 LVL 286
              V+
Sbjct:  4473 CVV 4475
GO:0006816 "calcium ion transport" evidence=TAS
GO:0005219 "ryanodine-sensitive calcium-release channel activity" evidence=ISS;NAS;TAS
GO:0016021 "integral to membrane" evidence=IEA;NAS
GO:0005789 "endoplasmic reticulum membrane" evidence=NAS
GO:0006936 "muscle contraction" evidence=IMP
GO:0070588 "calcium ion transmembrane transport" evidence=IEA
GO:0006874 "cellular calcium ion homeostasis" evidence=IEA
GO:0005509 "calcium ion binding" evidence=IEA
GO:0005875 "microtubule associated complex" evidence=IDA
GO:0035206 "regulation of hemocyte proliferation" evidence=IMP
UNIPROTKB|F1NYM2 RYR3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NCJ4 RYR3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NSR9 RYR3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|J9P355 RYR3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1PJL2 RYR3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q9TS33 Q9TS33 "Ryanodine receptor 3" [Oryctolagus cuniculus (taxid:9986)] Back     alignment and assigned GO terms
UNIPROTKB|B4DGV4 RYR2 "Ryanodine receptor 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P30957 RYR2 "Ryanodine receptor 2" [Oryctolagus cuniculus (taxid:9986)] Back     alignment and assigned GO terms
UNIPROTKB|H0YGL9 RYR2 "Ryanodine receptor 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q24498RY44_DROMENo assigned EC number0.71190.83560.0466yesN/A
E9Q401RYR2_MOUSENo assigned EC number0.67800.51040.0293yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 286
KOG2243|consensus 5019 100.0
PF1383354 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 96.31
cd0503088 calgranulins Calgranulins: S-100 domain found in p 92.87
PF1349966 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 92.43
PF0003629 EF-hand_1: EF hand; InterPro: IPR018248 Many calci 92.16
cd0502289 S-100A13 S-100A13: S-100A13 domain found in protei 91.71
cd0502788 S-100B S-100B: S-100B domain found in proteins sim 89.0
cd0502988 S-100A6 S-100A6: S-100A6 domain found in proteins 87.76
cd0502389 S-100A11 S-100A11: S-100A11 domain found in protei 86.8
cd0005267 EH Eps15 homology domain; found in proteins implic 86.35
cd0502693 S-100Z S-100Z: S-100Z domain found in proteins sim 84.29
smart0005429 EFh EF-hand, calcium binding motif. EF-hands are c 83.95
COG5126160 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S 83.72
PF1320225 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ 82.59
cd0021388 S-100 S-100: S-100 domain, which represents the la 81.14
>KOG2243|consensus Back     alignment and domain information 
Probab=100.00  E-value=2e-92  Score=730.94  Aligned_cols=243  Identities=48%  Similarity=0.806  Sum_probs=218.8

Q ss_pred             ccChhhHHHHHhccccCCCCceehhhHHHhhcchhhhhchhHHHHhhhccccCCCChhHHHHHHHhhhhhhcccccceeE
Q psy13307         41 FSSREDIEFMLACCETNHDGKIDYVGFTDRFHEPAKEIGFNLAVLLTNLSEHMPNEPRLARFLETASSVLNYFHPFLGRI  120 (286)
Q Consensus        41 ~~t~~EI~FLLsC~e~n~n~~idY~eF~eRFhePAkdIGFNlAVLLTNLsEHmP~D~RL~~FLe~A~svL~YFeP~LGRI  120 (286)
                      -|||+||+|||||+|+|+|+|+||++|++|||||||||||||||||||||||||||+||++||++|+||||||+||||||
T Consensus      4088 ~ytqse~dfllscae~dend~~~y~dfv~rfhepakdigfnvavlltnlsehmpndsrlk~~ld~aesvlnyfep~lgri 4167 (5019)
T KOG2243|consen 4088 HYTQSEIDFLLSCAEADENDMFDYEDFVDRFHEPAKDIGFNVAVLLTNLSEHMPNDSRLKCFLDLAESVLNYFEPFLGRI 4167 (5019)
T ss_pred             cchhHHHHHHHHhhccCccccccHHHHHHHhcCchhhcCcchhhhhhhhHhhCCCchhHHHHHhHHHHHHHhhhhhccee
Confidence            59999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEecCCcceeEEEEEecccchhhhccccccchhhhhhHHhhccCCcchhhhHHhhhhhHHHHHHHhhccccccccCCCCC
Q psy13307        121 EILGGSKRIERVYFEIKESNIEQWEKPQIKESKRAFFYSIVTEGGDKEKLEAFVNFCEDAIFEMQHASGLMAVEEGGGAG  200 (286)
Q Consensus       121 EImGsskRIERVYFeIseS~~~QWEkPQVKESKRqFlfdVVnEGGekeKmE~FVNFCEDTIFEMq~AsqIS~~d~~~~~~  200 (286)
                      ||||++|||||||||||||+|+|||||||||||||||||||||||++||||+|||||||||||||+|+|||++|.+++ +
T Consensus      4168 eimg~akkiervyfeisessrtqwekpqvkeskrqfifdvvneggekekmelfvnfcedtifemqlaaqisesd~~dr-p 4246 (5019)
T KOG2243|consen 4168 EIMGGAKKIERVYFEISESSRTQWEKPQVKESKRQFIFDVVNEGGEKEKMELFVNFCEDTIFEMQLAAQISESDLADR-P 4246 (5019)
T ss_pred             eeeccceeeeEEEEEecccccccccccchhhhhhhhhhhhhcccchHHHHHHHHHHHHHHHHHHHHHHhccccccccC-c
Confidence            999999999999999999999999999999999999999999999999999999999999999999999999987653 2


Q ss_pred             Cchhhhhhccc-cc--cCccccc-----CCCcccccccccccchhhhhcccCchhHHHHHHHHhcCChhHHHHHHHHHHH
Q psy13307        201 SGKARKQAYNY-LS--VDGEEEK-----NINPIRRGWQGFKDGIRFTLSMLSPSNIKQKINEMQQMSIPQLVVGFFKLFF  272 (286)
Q Consensus       201 ~~~~~~~~~~~-~~--~~~~~~~-----~~~~~~~~~~~~~~~~~~~~~~ls~~nlr~~~~~lr~mt~~e~~~~~~~~~~  272 (286)
                      ++++++++..+ ++  +++++++     +..++..+|.++++++..++.+.|++|||||+|++++||.++++.++|+++|
T Consensus      4247 e~~~~~edssyvle~~~~eee~~~l~~fs~~~~~~a~~a~k~ni~~~lk~~slk~lkkq~k~vkkmt~kdlv~~~fs~~w 4326 (5019)
T KOG2243|consen 4247 EEEAEDEDSSYVLEIAGEEEEDGRLAFFSALAFAMACAALKRNILDFLKMASLKNLKKQMKKVKKMTAKDLVKAFFSFFW 4326 (5019)
T ss_pred             hhhhcccchhhHHhhcCccccCCccchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhHHHHHHHHHHHHH
Confidence            23333332222 11  1222222     2345778899999999999999999999999999999999999999999999


Q ss_pred             HHHHhhhceeEe
Q psy13307        273 YAFYYSNYSVYL  284 (286)
Q Consensus       273 ~~~~~~~~~~~~  284 (286)
                      ++|+++++++++
T Consensus      4327 ~if~~l~~~~~s 4338 (5019)
T KOG2243|consen 4327 MIFMGLFHFLAS 4338 (5019)
T ss_pred             HHHHHHHHHHHH
Confidence            999988776544

>PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A Back     alignment and domain information
>cd05030 calgranulins Calgranulins: S-100 domain found in proteins belonging to the Calgranulin subgroup of the S100 family of EF-hand calcium-modulated proteins, including S100A8, S100A9, and S100A12 Back     alignment and domain information
>PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E Back     alignment and domain information
>PF00036 EF-hand_1: EF hand; InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand Back     alignment and domain information
>cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13 Back     alignment and domain information
>cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B Back     alignment and domain information
>cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6 Back     alignment and domain information
>cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11 Back     alignment and domain information
>cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction Back     alignment and domain information
>cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z Back     alignment and domain information
>smart00054 EFh EF-hand, calcium binding motif Back     alignment and domain information
>COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information
>PF13202 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ_B 1UHI_A 1UHH_B 1EJ3_B 1UHK_A 2ZFD_A 1UHN_A Back     alignment and domain information
>cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query286
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 42.1 bits (98), Expect = 2e-04
 Identities = 32/230 (13%), Positives = 66/230 (28%), Gaps = 54/230 (23%)

Query: 6   AVQDEPIKHELYAKQLSFIPETADFLIGCILFFFFFSSREDIEFMLACCETNHDGKIDYV 65
            V +     +++  +LS  P +A      +   +F   + D+  ++         +    
Sbjct: 364 NVLEPAEYRKMF-DRLSVFPPSAHIPTILLSLIWFDVIKSDVMVVVNKLHKYSLVEKQPK 422

Query: 66  GFTDRFHEPAKEIGFNLAVLLTNLSEHMPNEPRL-ARFLE-------------TASSVLN 111
             T                +   L   + NE  L    ++                 +  
Sbjct: 423 ESTISIPS-----------IYLELKVKLENEYALHRSIVDHYNIPKTFDSDDLIPPYLDQ 471

Query: 112 YFHPFLGR----IEILGGSKRIERVYFEIK--ESNIEQ----WEKP--------QIKESK 153
           YF+  +G     IE          V+ + +  E  I      W           Q+K  K
Sbjct: 472 YFYSHIGHHLKNIEHPERMTLFRMVFLDFRFLEQKIRHDSTAWNASGSILNTLQQLKFYK 531

Query: 154 RAFFYSIVTEGGDKEKLEAFVNF---CEDAIFEMQHAS----GLMAVEEG 196
               Y    +   +  + A ++F    E+ +   ++       LMA +E 
Sbjct: 532 P---YICDNDPKYERLVNAILDFLPKIEENLICSKYTDLLRIALMAEDEA 578

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query286
1h8b_A75 ACT-EF34, alpha-actinin 2, skeletal muscle isoform 95.05
2lmt_A148 Calmodulin-related protein 97A; spermatogenesis, m 94.36
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 94.13
2b1u_A71 Calmodulin-like protein 5; CLSP, calmodulin-like S 94.06
2lv7_A100 Calcium-binding protein 7; metal binding protein; 93.81
1wy9_A147 Allograft inflammatory factor 1; EF-hand, calucium 93.5
4eto_A93 Protein S100-A4; calcium-binding protein, EF-hand, 93.26
1c7v_A81 CAVP, calcium vector protein; EF-hand family, calc 93.24
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 93.11
3i5g_C159 Myosin catalytic light chain LC-1, mantle muscle; 93.08
3zwh_A104 Protein S100-A4; Ca-binding protein-motor protein 92.98
3nso_A101 Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta 92.87
3n22_A98 Protein S100-A2; EF-hand, calcium-binding, zinc-bi 92.85
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 92.83
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 92.8
3i5g_B153 Myosin regulatory light chain LC-2, mantle muscle; 92.78
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 92.77
2wcb_A95 Protein S100-A12; calcium signalling, HOST-parasit 92.74
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 92.66
1avs_A90 Troponin C; muscle contraction, calcium-activated, 92.52
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 92.5
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 92.35
3li6_A66 Calcium-binding protein; calcium signaling protein 92.35
1j55_A95 S-100P protein; metal binding protein; 2.00A {Homo 92.29
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 92.27
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 92.26
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 92.21
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 92.14
2kn2_A92 Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco 92.12
2y5i_A99 S100Z, S100 calcium binding protein Z; metal-bindi 92.1
1qx2_A76 Vitamin D-dependent calcium-binding protein, INTE; 92.08
2ktg_A85 Calmodulin, putative; ehcam, Ca-binding protein, p 92.02
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 91.98
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 91.95
3rm1_A92 Protein S100-B; alpha-helical, EF hand, metal bind 91.8
1cb1_A78 Calbindin D9K; calcium-binding protein; NMR {Sus s 91.68
2jnf_A158 Troponin C; stretch activated muscle contraction, 91.68
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 91.66
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 91.65
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 91.64
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 91.57
3nxa_A100 Protein S100-A16; S100 family, calcium binding pro 91.48
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 91.46
2kax_A92 Protein S100-A5; EF-hand, calcium binding protien, 91.36
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 91.31
3fwb_A161 Cell division control protein 31; gene gating, com 91.29
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 91.1
2lhi_A176 Calmodulin, serine/threonine-protein phosphatase c 91.06
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 90.98
1s6j_A87 CDPK, calcium-dependent protein kinase SK5; EF-han 90.97
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 90.78
1yx7_A83 Calsensin, LAN3-6 antigen; calcium-binding protein 90.72
1a4p_A96 S100A10; S100 family, EF-hand protein, ligand of a 90.71
2kyc_A108 Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p 90.71
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 90.69
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 90.67
2kz2_A94 Calmodulin, CAM; TR2C, metal binding protein; NMR 90.61
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 90.56
1qls_A99 S100C protein, calgizzarin; metal-binding protein/ 90.51
1k2h_A93 S100A1, S-100 protein, alpha chain; non-covalent h 90.51
2lnk_A113 Protein S100-A4; EF-hand, calcium binding, all alp 90.47
1fi6_A92 EH domain protein REPS1; EPS15 homology domain, EF 90.42
2h2k_A106 Protein S100-A13; calcium binding protein, metal b 90.37
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 90.33
1k8u_A90 S100A6, calcyclin, CACY; calcium regulatory protei 90.31
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 90.23
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 90.22
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 90.21
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 90.12
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 90.1
4drw_A121 Protein S100-A10/annexin A2 chimeric protein; atyp 90.02
1psr_A100 Psoriasin, S100A7; EF-hand protein, MAD phasing, p 90.01
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 89.98
1exr_A148 Calmodulin; high resolution, disorder, metal trans 89.97
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 89.92
1c07_A95 Protein (epidermal growth factor receptor pathway 89.66
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 89.5
1eh2_A106 EPS15; calcium binding, signaling domain, NPF bind 89.47
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 89.42
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 89.3
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 89.17
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 88.97
1qjt_A99 EH1, epidermal growth factor receptor substrate su 88.97
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 88.96
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 88.96
3akb_A166 Putative calcium binding protein; EF-hand, metal b 88.91
2d58_A107 Allograft inflammatory factor 1; EF-hand, metal bi 88.84
1xk4_C113 Calgranulin B; S100 family, heterotetramer, metal 88.53
1iq3_A110 Ralbp1-interacting protein (partner of ralbp1); EF 88.46
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 88.18
2kld_A123 Polycystin-2; PC2, PKD2, calcium binding domain, E 88.06
2kgr_A111 Intersectin-1; structure, alternative splicing, ca 88.04
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 87.88
2qac_A146 Myosin A tail domain interacting protein MTIP; mal 87.37
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 87.3
1xk4_A93 Calgranulin A; S100 family, heterotetramer, metal 86.96
2jq6_A139 EH domain-containing protein 1; metal binding prot 86.68
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 86.48
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 86.32
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 86.11
2hps_A186 Coelenterazine-binding protein with bound coelent; 86.03
3a8r_A179 Putative uncharacterized protein; EF-hand, membran 85.36
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 85.31
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 85.31
2jnf_A158 Troponin C; stretch activated muscle contraction, 84.73
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 84.33
3fwb_A161 Cell division control protein 31; gene gating, com 84.05
2jjz_A150 Ionized calcium-binding adapter molecule 2; EF-han 83.92
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 83.83
1j7q_A86 CAVP, calcium vector protein; EF-hand family, calc 83.74
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 83.58
1dgu_A183 Calcium-saturated CIB; helical, EF-hands, blood cl 83.5
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 83.47
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 83.45
1y1x_A191 Leishmania major homolog of programmed cell death 83.35
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 82.84
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 82.79
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 82.49
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 82.23
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 81.92
1exr_A148 Calmodulin; high resolution, disorder, metal trans 81.63
2lvv_A226 Flagellar calcium-binding protein TB-24; EF-hand, 81.23
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 80.82
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 80.3
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 80.26
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 80.23
>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Back     alignment and structure
>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A Back     alignment and structure
>4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* Back     alignment and structure
>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Back     alignment and structure
>3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C Back     alignment and structure
>3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens} Back     alignment and structure
>3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Back     alignment and structure
>3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Back     alignment and structure
>2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Back     alignment and structure
>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Back     alignment and structure
>1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Back     alignment and structure
>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Back     alignment and structure
>2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio} Back     alignment and structure
>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Back     alignment and structure
>3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... Back     alignment and structure
>1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Back     alignment and structure
>3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A Back     alignment and structure
>2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Back     alignment and structure
>2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Back     alignment and structure
>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Back     alignment and structure
>1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A Back     alignment and structure
>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Back     alignment and structure
>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Back     alignment and structure
>1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A Back     alignment and structure
>1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A Back     alignment and structure
>2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A Back     alignment and structure
>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Back     alignment and structure
>1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Back     alignment and structure
>4drw_A Protein S100-A10/annexin A2 chimeric protein; atypical EF-hand, heteropentameric complex, membrane repair; 3.50A {Homo sapiens} Back     alignment and structure
>1psr_A Psoriasin, S100A7; EF-hand protein, MAD phasing, psoriasis, S100 protein family; 1.05A {Homo sapiens} SCOP: a.39.1.2 PDB: 2psr_A 2wor_A* 2wos_A* 3psr_A 2wnd_A Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Back     alignment and structure
>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Back     alignment and structure
>1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Back     alignment and structure
>1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Back     alignment and structure
>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} Back     alignment and structure
>1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A* Back     alignment and structure
>1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Back     alignment and structure
>2kld_A Polycystin-2; PC2, PKD2, calcium binding domain, EF hand, cytosolic, calcium, coiled coil, disease mutation, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kle_A 2kq6_A 2y4q_A Back     alignment and structure
>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Back     alignment and structure
>1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A Back     alignment and structure
>2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Back     alignment and structure
>3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A Back     alignment and structure
>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Back     alignment and structure
>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Back     alignment and structure
>2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query286
d2fcea161 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 96.46
d1fw4a_65 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 95.6
d1wlza183 DJ-1-binding protein, DJBP {Human (Homo sapiens) [ 95.51
d1c7va_68 Calcium vector protein {Amphioxus (Branchiostoma l 95.34
d1m45a_146 Myosin Light Chain Mlc1p {Baker's yeast (Saccharom 94.6
d1oqpa_77 Caltractin (centrin 2) {Green algae (Chlamydomonas 94.58
d1tiza_67 Calmodulin-related protein T21P5.17 {Thale cress ( 94.26
d1fi5a_81 Troponin C {Chicken (Gallus gallus), cardiac isofo 94.08
d1rwya_109 Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} 94.06
d5pala_109 Parvalbumin {Leopard shark (Triakis semifasciata) 93.89
d1qx2a_76 Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} 93.67
d1uhka1187 Calcium-regulated photoprotein {Jellyfish (Aequore 93.67
d2pq3a173 Calmodulin {Rattus norvegicus [TaxId: 10116]} 93.57
d1pvaa_109 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 93.41
d1jc2a_75 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 93.33
d1rroa_108 Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 93.32
d1dtla_156 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 93.24
d1avsa_81 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 93.04
d1nyaa_176 Calerythrin {Saccharopolyspora erythraea [TaxId: 1 93.02
d1wrka182 Troponin C {Human (Homo sapiens), cardiac isoform 92.86
d1ggwa_140 Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ 92.65
d2obha1141 Calmodulin {Human (Homo sapiens) [TaxId: 9606]} 92.33
d2mysc_145 Myosin Regulatory Chain {Chicken (Gallus gallus) [ 92.11
d1qv0a_189 Calcium-regulated photoprotein {Hydrozoa (Obelia l 92.02
d2sasa_185 Sarcoplasmic calcium-binding protein {Amphioxus (B 91.99
d1cb1a_78 Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} 91.87
d1f54a_77 Calmodulin {Baker's yeast (Saccharomyces cerevisia 91.81
d1s6ja_87 Calcium-dependent protein kinase sk5 CLD {Soybean 91.78
d2opoa181 Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta 91.71
d2pvba_107 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 91.44
d1yuta198 Calcyclin (S100) {Human (Homo sapiens), s100a13 [T 91.1
d1a4pa_92 Calcyclin (S100) {Human (Homo sapiens), P11 s100a1 91.03
d1wdcc_152 Myosin Regulatory Chain {Bay scallop (Aequipecten 91.02
d3c1va193 Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta 90.78
d1zfsa193 Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 90.58
d1w7jb1139 Myosin Essential Chain {Human (Homo sapiens) [TaxI 90.39
d1xk4a187 Calcyclin (S100) {Human (Homo sapiens), calgranuli 89.98
d1topa_162 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 89.73
d2mysb_145 Myosin Essential Chain {Chicken (Gallus gallus) [T 88.98
d1wdcb_142 Myosin Essential Chain {Bay scallop (Aequipecten i 88.61
d1lkja_146 Calmodulin {Baker's yeast (Saccharomyces cerevisia 88.26
d1k8ua_89 Calcyclin (S100) {Human (Homo sapiens), s100a6 [Ta 87.58
d1psra_100 Calcyclin (S100) {Human (Homo sapiens), psoriasin 86.23
d1e8aa_87 Calcyclin (S100) {Human (Homo sapiens), calgranuli 85.81
d1ksoa_93 Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta 84.59
d1s6ia_182 Calcium-dependent protein kinase sk5 CLD {Soybean 84.57
d1exra_146 Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI 82.71
d1ij5a_321 Cbp40 (plasmodial specific CaII-binding protein LA 82.35
d2scpa_174 Sarcoplasmic calcium-binding protein {Sandworm (Ne 81.66
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
class: All alpha proteins
fold: EF Hand-like
superfamily: EF-hand
family: Calmodulin-like
domain: Calmodulin
species: Cow (Bos taurus) [TaxId: 9913]

Probab=96.46  E-value=0.0013  Score=44.44  Aligned_cols=32  Identities=22%  Similarity=0.377  Sum_probs=28.7

Q ss_pred             hhhccChhhHHHHHhccccCCCCceehhhHHH
Q psy13307         38 FFFFSSREDIEFMLACCETNHDGKIDYVGFTD   69 (286)
Q Consensus        38 ~~~~~t~~EI~FLLsC~e~n~n~~idY~eF~e   69 (286)
                      +-.-.|+.||+-|+.+++.|+||+|||+||++
T Consensus        30 ~g~~~~~~ei~~l~~~~D~d~dg~I~~~eFl~   61 (61)
T d2fcea1          30 LGEKLTDAEVDELLKGVEVDSNGEIDYKKFIE   61 (61)
T ss_dssp             TTCCCCHHHHHHHHTTCCCCTTSEECHHHHHH
T ss_pred             cCCCCCHHHHHHHHHHcCCCCCCcEeHHHhcC
Confidence            34557899999999999999999999999985
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Back     information, alignment and structure
>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} Back     information, alignment and structure
>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} Back     information, alignment and structure
>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Back     information, alignment and structure
>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} Back     information, alignment and structure
>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} Back     information, alignment and structure
>d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} Back     information, alignment and structure
>d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} Back     information, alignment and structure
>d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} Back     information, alignment and structure
>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Back     information, alignment and structure