Diaphorina citri psyllid: psy13333


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110----
HLRVVFDFGFERQELIFPNKHFGLGQYHDIRIRRKNSGATLLMQVDSYEPKEFHFNIKDSADAQFNNIQYMYIGRNESMTEGFIGCVSRVEFDDIYPLKLLFQEDGPANVRSIG
cEEEEEEcccccEEEEcccccccccccCEEEEEEEccccEEEEEccccccEEEEEEcccccccccccEEEEEEEcccccccccEEEEEEEEEcccHHHHHcccccccccCECcc
HLRVVFDFGFERQELIFPNKHFGLGQYHDIRIRRKNSGATLLMQVDSYEPKEFHFNIKDSADAQFNNIQYMYIGRNESMTEGFIGCVSRVEFDDIYPLKLLFQ***********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
HLRVVFDFGFERQELIFPNKHFGLGQYHDIRIRRKNSGATLLMQVDSYEPKEFHFNIKDSADAQFNNIQYMYIGRNESMTEGFIGCVSRVEFDDIYPLKLLFQEDGPANVRSIG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Neurexin-4 Seems to play a role in the formation and function of septate junctions. Septate junctions, which are the equivalent of vertebrates tight junctions, are characterized by regular arrays of transverse structures that span the intermembrane space and form a physical barrier to diffusion. Required for the blood-brain barrier formation.confidentQ94887

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005919 [CC]pleated septate junctionprobableGO:0070160, GO:0005575, GO:0005911, GO:0043296, GO:0030054, GO:0005918
GO:0008104 [BP]protein localizationprobableGO:0033036, GO:0008150, GO:0051179
GO:0060857 [BP]establishment of glial blood-brain barrierprobableGO:0032502, GO:0048856, GO:0007399, GO:0021782, GO:0009987, GO:0048869, GO:0030154, GO:0048468, GO:0042063, GO:0044767, GO:0032501, GO:0044763, GO:0060856, GO:0010001, GO:0048731, GO:0008150, GO:0022008, GO:0007275, GO:0044699, GO:0044707
GO:0021682 [BP]nerve maturationprobableGO:0032502, GO:0032501, GO:0044707, GO:0007399, GO:0048856, GO:0044767, GO:0008150, GO:0044699, GO:0048731, GO:0021675, GO:0010259, GO:0007275, GO:0071695
GO:0035151 [BP]regulation of tube size, open tracheal systemprobableGO:0035150, GO:0007424, GO:0035152, GO:0032501, GO:0044707, GO:0060541, GO:0048856, GO:0090066, GO:0008150, GO:0065007, GO:0048731, GO:0065008, GO:0032502, GO:0007275, GO:0044699
GO:0008039 [BP]synaptic target recognitionprobableGO:0048666, GO:0008037, GO:0048699, GO:0032501, GO:0030182, GO:0044707, GO:0048869, GO:0030154, GO:0048468, GO:0007399, GO:0008038, GO:0044767, GO:0044763, GO:0048731, GO:0007275, GO:0008150, GO:0009987, GO:0032502, GO:0022008, GO:0044699, GO:0048856
GO:0045216 [BP]cell-cell junction organizationprobableGO:0034330, GO:0009987, GO:0016043, GO:0044763, GO:0044699, GO:0008150, GO:0071840
GO:0008366 [BP]axon ensheathmentprobableGO:0042391, GO:0019226, GO:0035637, GO:0050801, GO:0019228, GO:0042592, GO:0023052, GO:0001508, GO:0007272, GO:0007275, GO:0044699, GO:0065007, GO:0019725, GO:0065008, GO:0032502, GO:0032501, GO:0050877, GO:0009987, GO:0006873, GO:0008150, GO:0048731, GO:0007154, GO:0055082, GO:0003008, GO:0044700, GO:0044707, GO:0007399, GO:0048856, GO:0048878, GO:0044763

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3QCW, chain A
Confidence level:very confident
Coverage over the Query: 1-111
View the alignment between query and template
View the model in PyMOL