Diaphorina citri psyllid: psy1333


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------8
MVTQSDTNNVPRAMLMAMFINGLTNEETIALTKSMVDSGETLSWGPEGIVVDKHSTGGVGDKVSIPLVPALAACGLKPS
ccccccccHHHHHHHHHHHHccccHHHHHHHHHHHHccccCEEccccccccccccccccccccHHHHHHHHHHcccccc
MVTQSDTNNVPRAMLMAMFINGLTNEETIALTKSMVDSGETLSWGPEGIVVDKHSTGGVGDKVSIPLVPALAACGLKPS
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVTQSDTNNVPRAMLMAMFINGLTNEETIALTKSMVDSGETLSWGPEGIVVDKHSTGGVGDKVSIPLVPALAACGLKPS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Thymidine phosphorylase The enzymes which catalyze the reversible phosphorolysis of pyrimidine nucleosides are involved in the degradation of these compounds and in their utilization as carbon and energy sources, or in the rescue of pyrimidine bases for nucleotide synthesis.confidentQ8EHK3
Thymidine phosphorylase The enzymes which catalyze the reversible phosphorolysis of pyrimidine nucleosides are involved in the degradation of these compounds and in their utilization as carbon and energy sources, or in the rescue of pyrimidine bases for nucleotide synthesis.confidentA9KZ79
Thymidine phosphorylase The enzymes which catalyze the reversible phosphorolysis of pyrimidine nucleosides are involved in the degradation of these compounds and in their utilization as carbon and energy sources, or in the rescue of pyrimidine bases for nucleotide synthesis.confidentB8CKI5

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0016763 [MF]transferase activity, transferring pentosyl groupsprobableGO:0003824, GO:0016740, GO:0003674, GO:0016757

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2DSJ, chain A
Confidence level:very confident
Coverage over the Query: 1-79
View the alignment between query and template
View the model in PyMOL