Psyllid ID: psy1333


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------8
MVTQSDTNNVPRAMLMAMFINGLTNEETIALTKSMVDSGETLSWGPEGIVVDKHSTGGVGDKVSIPLVPALAACGLKPS
ccccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHcccEEEccccccccccccccccccccHHHHHHHHHHcccccc
cccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHccccccEcccccccEEEEEcccccccHHHHHHHHHHHcccccc
mvtqsdtnnVPRAMLMAMFINGLTNEETIALTKSMvdsgetlswgpegivvdkhstggvgdkvsipLVPALAACGLKPS
mvtqsdtnnvprAMLMAMFINGLTNEETIALTKSMVDSGETLSWGPEGIVVDKHStggvgdkvsiPLVPALAACGLKPS
MVTQSDTNNVPRAMLMAMFINGLTNEETIALTKSMVDSGETLSWGPEGIVVDKHSTGGVGDKVSIPLVPALAACGLKPS
************AMLMAMFINGLTNEETIALTKSMVDSGETLSWGPEGIVVDKHSTGGVGDKVSIPLVPALAACG****
MVTQSDTNNVPRAMLMAMFINGLTNEETIALTKSMVDSGETLSWGPEGIVVDKHSTGGVGDKVSIPLVPALAACGLKPS
MVTQSDTNNVPRAMLMAMFINGLTNEETIALTKSMVDSGETLSWGPEGIVVDKHSTGGVGDKVSIPLVPALAACGLKPS
**TQSDTNNVPRAMLMAMFINGLTNEETIALTKSMVDSGETLSWGPEGIVVDKHSTGGVGDKVSIPLVPALAACGLKP*
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVTQSDTNNVPRAMLMAMFINGLTNEETIALTKSMVDSGETLSWGPEGIVVDKHSTGGVGDKVSIPLVPALAACGLKPS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query79 2.2.26 [Sep-21-2011]
A6UET3 438 Thymidine phosphorylase O yes N/A 0.797 0.143 0.593 6e-14
Q99N42 471 Thymidine phosphorylase O yes N/A 0.810 0.135 0.573 1e-13
P19971 482 Thymidine phosphorylase O yes N/A 0.810 0.132 0.588 1e-13
Q483R6 438 Thymidine phosphorylase O yes N/A 0.797 0.143 0.578 1e-13
Q5FVR2 476 Thymidine phosphorylase O yes N/A 0.810 0.134 0.573 2e-13
P47717 419 Thymidine phosphorylase O N/A N/A 0.962 0.181 0.474 3e-12
Q92T50 440 Thymidine phosphorylase O yes N/A 0.797 0.143 0.546 5e-12
A1S475 443 Thymidine phosphorylase O yes N/A 0.797 0.142 0.545 9e-12
C3MBH0 438 Thymidine phosphorylase O yes N/A 0.797 0.143 0.531 1e-11
Q5QXT8 446 Thymidine phosphorylase O yes N/A 0.797 0.141 0.515 2e-11
>sp|A6UET3|TYPH_SINMW Thymidine phosphorylase OS=Sinorhizobium medicae (strain WSM419) GN=deoA PE=3 SV=1 Back     alignment and function desciption
 Score = 75.9 bits (185), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 48/64 (75%), Gaps = 1/64 (1%)

Query: 13  AMLMAMFINGLTNEETIALTKSMVDSGETLSWGPEGI-VVDKHSTGGVGDKVSIPLVPAL 71
           A  MA++ +G++ +E +ALT +M DSGETL WG  G  VVDKHSTGGVGD VS+ L P +
Sbjct: 42  AFAMAVWFSGMSRDECVALTLAMRDSGETLDWGEFGRPVVDKHSTGGVGDNVSLMLAPIV 101

Query: 72  AACG 75
           AACG
Sbjct: 102 AACG 105




The enzymes which catalyze the reversible phosphorolysis of pyrimidine nucleosides are involved in the degradation of these compounds and in their utilization as carbon and energy sources, or in the rescue of pyrimidine bases for nucleotide synthesis.
Sinorhizobium medicae (strain WSM419) (taxid: 366394)
EC: 2EC: .EC: 4EC: .EC: 2EC: .EC: 4
>sp|Q99N42|TYPH_MOUSE Thymidine phosphorylase OS=Mus musculus GN=Tymp PE=2 SV=1 Back     alignment and function description
>sp|P19971|TYPH_HUMAN Thymidine phosphorylase OS=Homo sapiens GN=TYMP PE=1 SV=2 Back     alignment and function description
>sp|Q483R6|TYPH_COLP3 Thymidine phosphorylase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=deoA PE=3 SV=1 Back     alignment and function description
>sp|Q5FVR2|TYPH_RAT Thymidine phosphorylase OS=Rattus norvegicus GN=Tymp PE=2 SV=1 Back     alignment and function description
>sp|P47717|TYPH_MYCPI Thymidine phosphorylase OS=Mycoplasma pirum GN=deoA PE=3 SV=1 Back     alignment and function description
>sp|Q92T50|TYPH_RHIME Thymidine phosphorylase OS=Rhizobium meliloti (strain 1021) GN=deoA PE=3 SV=1 Back     alignment and function description
>sp|A1S475|TYPH_SHEAM Thymidine phosphorylase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=deoA PE=3 SV=1 Back     alignment and function description
>sp|C3MBH0|TYPH_RHISN Thymidine phosphorylase OS=Rhizobium sp. (strain NGR234) GN=deoA PE=3 SV=1 Back     alignment and function description
>sp|Q5QXT8|TYPH_IDILO Thymidine phosphorylase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=deoA PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query79
260800029 456 hypothetical protein BRAFLDRAFT_244533 [ 0.822 0.142 0.686 4e-18
156391847 463 predicted protein [Nematostella vectensi 0.822 0.140 0.656 2e-17
221110419110 PREDICTED: thymidine phosphorylase-like, 0.822 0.590 0.716 2e-17
209730558157 Thymidine phosphorylase [Salmo salar] 0.822 0.414 0.656 2e-16
443696029 409 hypothetical protein CAPTEDRAFT_177354 [ 0.822 0.158 0.641 3e-16
213511662 453 Thymidine phosphorylase [Salmo salar] gi 0.822 0.143 0.656 3e-16
34330119 456 spermatogonial stem-cell renewal factor 0.822 0.142 0.656 3e-16
327287908 690 PREDICTED: thymidine phosphorylase-like 0.810 0.092 0.647 6e-16
405969967 450 Thymidine phosphorylase [Crassostrea gig 0.822 0.144 0.661 7e-16
390365913 436 PREDICTED: thymidine phosphorylase-like 0.822 0.149 0.671 2e-15
>gi|260800029|ref|XP_002594939.1| hypothetical protein BRAFLDRAFT_244533 [Branchiostoma floridae] gi|229280177|gb|EEN50950.1| hypothetical protein BRAFLDRAFT_244533 [Branchiostoma floridae] Back     alignment and taxonomy information
 Score = 95.1 bits (235), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 46/67 (68%), Positives = 56/67 (83%), Gaps = 2/67 (2%)

Query: 13  AMLMAMFINGLTNEETIALTKSMVDSGETLSWGPE--GIVVDKHSTGGVGDKVSIPLVPA 70
           AMLMA+F+NG+  +ET  LT++M DSG TLS+  E  G+VVDKHSTGGVGDK+S+PL PA
Sbjct: 43  AMLMAIFLNGMNRDETTTLTRAMRDSGSTLSFPAEWAGLVVDKHSTGGVGDKISLPLAPA 102

Query: 71  LAACGLK 77
           LAACGLK
Sbjct: 103 LAACGLK 109




Source: Branchiostoma floridae

Species: Branchiostoma floridae

Genus: Branchiostoma

Family: Branchiostomidae

Order:

Class:

Phylum: Chordata

Superkingdom: Eukaryota

>gi|156391847|ref|XP_001635761.1| predicted protein [Nematostella vectensis] gi|156222858|gb|EDO43698.1| predicted protein [Nematostella vectensis] Back     alignment and taxonomy information
>gi|221110419|ref|XP_002156363.1| PREDICTED: thymidine phosphorylase-like, partial [Hydra magnipapillata] Back     alignment and taxonomy information
>gi|209730558|gb|ACI66148.1| Thymidine phosphorylase [Salmo salar] Back     alignment and taxonomy information
>gi|443696029|gb|ELT96810.1| hypothetical protein CAPTEDRAFT_177354 [Capitella teleta] Back     alignment and taxonomy information
>gi|213511662|ref|NP_001133751.1| Thymidine phosphorylase [Salmo salar] gi|209155212|gb|ACI33838.1| Thymidine phosphorylase precursor [Salmo salar] Back     alignment and taxonomy information
>gi|34330119|dbj|BAC82441.1| spermatogonial stem-cell renewal factor [Anguilla japonica] Back     alignment and taxonomy information
>gi|327287908|ref|XP_003228670.1| PREDICTED: thymidine phosphorylase-like [Anolis carolinensis] Back     alignment and taxonomy information
>gi|405969967|gb|EKC34910.1| Thymidine phosphorylase [Crassostrea gigas] Back     alignment and taxonomy information
>gi|390365913|ref|XP_796867.3| PREDICTED: thymidine phosphorylase-like [Strongylocentrotus purpuratus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query79
UNIPROTKB|C9JGI3 445 TYMP "Thymidine phosphorylase" 0.810 0.143 0.588 1.1e-13
MGI|MGI:1920212 471 Tymp "thymidine phosphorylase" 0.810 0.135 0.573 1.2e-13
UNIPROTKB|P19971 482 TYMP "Thymidine phosphorylase" 0.810 0.132 0.588 1.3e-13
RGD|1305756 476 Tymp "thymidine phosphorylase" 0.810 0.134 0.573 2e-13
UNIPROTKB|Q5FVR2 476 Tymp "Thymidine phosphorylase" 0.810 0.134 0.573 2e-13
TIGR_CMR|CPS_1970 438 CPS_1970 "thymidine phosphoryl 0.797 0.143 0.578 2.8e-13
TIGR_CMR|SO_1218 443 SO_1218 "thymidine phosphoryla 0.797 0.142 0.515 5.5e-11
TIGR_CMR|SPO_2929 436 SPO_2929 "thymidine phosphoryl 0.797 0.144 0.523 8.8e-11
UNIPROTKB|Q3ABU8 442 pdp "Pyrimidine-nucleoside pho 0.810 0.144 0.492 1.9e-10
TIGR_CMR|CHY_1554 442 CHY_1554 "pyrimidine-nucleosid 0.810 0.144 0.492 1.9e-10
UNIPROTKB|C9JGI3 TYMP "Thymidine phosphorylase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
 Score = 185 (70.2 bits), Expect = 1.1e-13, P = 1.1e-13
 Identities = 40/68 (58%), Positives = 49/68 (72%)

Query:    13 AMLMAMFINGLTNEETIALTKSMVDSGETLSWGPEGI---VVDKHSTGGVGDKVSIPLVP 69
             AMLMA+ + G+  EET  LT+++  SG+ L W PE     +VDKHSTGGVGDKVS+ L P
Sbjct:    73 AMLMAIRLRGMDLEETSVLTQALAQSGQQLEW-PEAWRQQLVDKHSTGGVGDKVSLVLAP 131

Query:    70 ALAACGLK 77
             ALAACG K
Sbjct:   132 ALAACGCK 139




GO:0004645 "phosphorylase activity" evidence=IEA
GO:0006206 "pyrimidine nucleobase metabolic process" evidence=IEA
GO:0006213 "pyrimidine nucleoside metabolic process" evidence=IEA
GO:0016763 "transferase activity, transferring pentosyl groups" evidence=IEA
MGI|MGI:1920212 Tymp "thymidine phosphorylase" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|P19971 TYMP "Thymidine phosphorylase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|1305756 Tymp "thymidine phosphorylase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q5FVR2 Tymp "Thymidine phosphorylase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
TIGR_CMR|CPS_1970 CPS_1970 "thymidine phosphorylase" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
TIGR_CMR|SO_1218 SO_1218 "thymidine phosphorylase" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_2929 SPO_2929 "thymidine phosphorylase" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
UNIPROTKB|Q3ABU8 pdp "Pyrimidine-nucleoside phosphorylase" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
TIGR_CMR|CHY_1554 CHY_1554 "pyrimidine-nucleoside phosphorylase" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8EHK3TYPH_SHEON2, ., 4, ., 2, ., 40.51510.79740.1422yesN/A
A9KZ79TYPH_SHEB92, ., 4, ., 2, ., 40.53030.79740.1422yesN/A
B8CKI5TYPH_SHEPW2, ., 4, ., 2, ., 40.51510.79740.1422yesN/A
A0KPE3TYPH_AERHH2, ., 4, ., 2, ., 40.50720.75940.1354yesN/A
B4EPB7TYPH_BURCJ2, ., 4, ., 2, ., 40.51510.79740.1438yesN/A
B8E6P5TYPH_SHEB22, ., 4, ., 2, ., 40.53030.79740.1422yesN/A
P19971TYPH_HUMAN2, ., 4, ., 2, ., 40.58820.81010.1327yesN/A
A1RH88TYPH_SHESW2, ., 4, ., 2, ., 40.53030.79740.1422yesN/A
Q8UJ08TYPH_AGRT52, ., 4, ., 2, ., 40.57890.70880.1278yesN/A
Q1BV59TYPH_BURCA2, ., 4, ., 2, ., 40.51510.79740.1438yesN/A
Q0HLE9TYPH_SHESM2, ., 4, ., 2, ., 40.53030.79740.1422yesN/A
Q5FVR2TYPH_RAT2, ., 4, ., 2, ., 40.57350.81010.1344yesN/A
A3D7J3TYPH_SHEB52, ., 4, ., 2, ., 40.51510.79740.1422yesN/A
B5FA99TYPH_VIBFM2, ., 4, ., 2, ., 40.51510.79740.1422yesN/A
Q92T50TYPH_RHIME2, ., 4, ., 2, ., 40.54680.79740.1431yesN/A
P75052TYPH_MYCPN2, ., 4, ., 2, ., 40.53220.77210.1448yesN/A
Q9KPL8TYPH_VIBCH2, ., 4, ., 2, ., 40.51510.79740.1406yesN/A
Q0HXQ3TYPH_SHESR2, ., 4, ., 2, ., 40.53030.79740.1422yesN/A
Q39PA6TYPH_BURS32, ., 4, ., 2, ., 40.51510.79740.1438yesN/A
A4Y9A7TYPH_SHEPC2, ., 4, ., 2, ., 40.53030.79740.1422yesN/A
A1S475TYPH_SHEAM2, ., 4, ., 2, ., 40.54540.79740.1422yesN/A
Q5QXT8TYPH_IDILO2, ., 4, ., 2, ., 40.51510.79740.1412yesN/A
A8FYQ8TYPH_SHESH2, ., 4, ., 2, ., 40.51510.79740.1422yesN/A
Q2NW05TYPH_SODGM2, ., 4, ., 2, ., 40.51510.79740.1422yesN/A
B6ENG4TYPH_ALISL2, ., 4, ., 2, ., 40.51510.79740.1422yesN/A
Q483R6TYPH_COLP32, ., 4, ., 2, ., 40.57810.79740.1438yesN/A
B1KC83TYPH_BURCC2, ., 4, ., 2, ., 40.53030.79740.1438yesN/A
A4SRU3TYPH_AERS42, ., 4, ., 2, ., 40.50720.75940.1354yesN/A
P47297TYPH_MYCGE2, ., 4, ., 2, ., 40.52300.81010.1520yesN/A
Q5E7J6TYPH_VIBF12, ., 4, ., 2, ., 40.51510.79740.1422yesN/A
A6WRB7TYPH_SHEB82, ., 4, ., 2, ., 40.53030.79740.1422yesN/A
Q98GV5TYPH_RHILO2, ., 4, ., 2, ., 40.57140.69620.1252yesN/A
C3MBH0TYPH_RHISN2, ., 4, ., 2, ., 40.53120.79740.1438yesN/A
Q87M23TYPH_VIBPA2, ., 4, ., 2, ., 40.50720.75940.1357yesN/A
A0KU08TYPH_SHESA2, ., 4, ., 2, ., 40.53030.79740.1422yesN/A
B1KRP7TYPH_SHEWM2, ., 4, ., 2, ., 40.51510.79740.1422yesN/A
A6UET3TYPH_SINMW2, ., 4, ., 2, ., 40.59370.79740.1438yesN/A
Q99N42TYPH_MOUSE2, ., 4, ., 2, ., 40.57350.81010.1358yesN/A
A0KCQ9TYPH_BURCH2, ., 4, ., 2, ., 40.51510.79740.1438yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query79
PRK05820 440 PRK05820, deoA, thymidine phosphorylase; Reviewed 7e-29
TIGR02644 405 TIGR02644, Y_phosphoryl, pyrimidine-nucleoside pho 3e-28
COG0213 435 COG0213, DeoA, Thymidine phosphorylase [Nucleotide 3e-27
PRK04350 490 PRK04350, PRK04350, thymidine phosphorylase; Provi 2e-20
TIGR02643 437 TIGR02643, T_phosphoryl, thymidine phosphorylase 4e-19
PRK06078 434 PRK06078, PRK06078, pyrimidine-nucleoside phosphor 1e-16
TIGR03327 500 TIGR03327, AMP_phos, AMP phosphorylase 1e-15
TIGR02645 493 TIGR02645, ARCH_P_rylase, putative thymidine phosp 3e-15
pfam0288566 pfam02885, Glycos_trans_3N, Glycosyl transferase f 4e-06
pfam00591 254 pfam00591, Glycos_transf_3, Glycosyl transferase f 4e-05
TIGR01245 330 TIGR01245, trpD, anthranilate phosphoribosyltransf 0.001
>gnl|CDD|180276 PRK05820, deoA, thymidine phosphorylase; Reviewed Back     alignment and domain information
 Score =  105 bits (265), Expect = 7e-29
 Identities = 38/66 (57%), Positives = 47/66 (71%), Gaps = 3/66 (4%)

Query: 13  AMLMAMFINGLTNEETIALTKSMVDSGETLSW---GPEGIVVDKHSTGGVGDKVSIPLVP 69
           A+ MA+F NG+T  E +ALT +M DSGE L W      G +VDKHSTGGVGDK+S+ L P
Sbjct: 41  ALAMAIFFNGMTRPERVALTLAMRDSGEVLDWSSLNLNGPIVDKHSTGGVGDKISLMLAP 100

Query: 70  ALAACG 75
            +AACG
Sbjct: 101 MVAACG 106


Length = 440

>gnl|CDD|233961 TIGR02644, Y_phosphoryl, pyrimidine-nucleoside phosphorylase Back     alignment and domain information
>gnl|CDD|223291 COG0213, DeoA, Thymidine phosphorylase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|235289 PRK04350, PRK04350, thymidine phosphorylase; Provisional Back     alignment and domain information
>gnl|CDD|131691 TIGR02643, T_phosphoryl, thymidine phosphorylase Back     alignment and domain information
>gnl|CDD|180387 PRK06078, PRK06078, pyrimidine-nucleoside phosphorylase; Reviewed Back     alignment and domain information
>gnl|CDD|132370 TIGR03327, AMP_phos, AMP phosphorylase Back     alignment and domain information
>gnl|CDD|233962 TIGR02645, ARCH_P_rylase, putative thymidine phosphorylase Back     alignment and domain information
>gnl|CDD|145834 pfam02885, Glycos_trans_3N, Glycosyl transferase family, helical bundle domain Back     alignment and domain information
>gnl|CDD|216013 pfam00591, Glycos_transf_3, Glycosyl transferase family, a/b domain Back     alignment and domain information
>gnl|CDD|233329 TIGR01245, trpD, anthranilate phosphoribosyltransferase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 79
TIGR02644 405 Y_phosphoryl pyrimidine-nucleoside phosphorylase. 99.96
TIGR02643 437 T_phosphoryl thymidine phosphorylase. Thymidine ph 99.95
PRK05820 440 deoA thymidine phosphorylase; Reviewed 99.95
COG0547 338 TrpD Anthranilate phosphoribosyltransferase [Amino 99.95
PRK06078 434 pyrimidine-nucleoside phosphorylase; Reviewed 99.94
PRK04350 490 thymidine phosphorylase; Provisional 99.94
PRK07394 342 hypothetical protein; Provisional 99.93
TIGR01245 330 trpD anthranilate phosphoribosyltransferase. In ma 99.93
TIGR03327 500 AMP_phos AMP phosphorylase. This enzyme family is 99.93
PRK08136 317 glycosyl transferase family protein; Provisional 99.93
PRK09522 531 bifunctional glutamine amidotransferase/anthranila 99.93
TIGR02645 493 ARCH_P_rylase putative thymidine phosphorylase. Me 99.92
PLN02641 343 anthranilate phosphoribosyltransferase 99.92
PRK14607 534 bifunctional glutamine amidotransferase/anthranila 99.92
PRK00188 339 trpD anthranilate phosphoribosyltransferase; Provi 99.91
COG0213 435 DeoA Thymidine phosphorylase [Nucleotide transport 99.91
PRK09071 323 hypothetical protein; Validated 99.89
PF0288566 Glycos_trans_3N: Glycosyl transferase family, heli 99.58
PF00591 252 Glycos_transf_3: Glycosyl transferase family, a/b 99.23
KOG1438|consensus 373 99.01
PF0288566 Glycos_trans_3N: Glycosyl transferase family, heli 82.04
>TIGR02644 Y_phosphoryl pyrimidine-nucleoside phosphorylase Back     alignment and domain information
Probab=99.96  E-value=1.5e-29  Score=194.54  Aligned_cols=79  Identities=52%  Similarity=0.748  Sum_probs=74.5

Q ss_pred             CCCCCCChHHHHHHHHHHHhcCCCHHHHHHHHHHHHhhCCccCCCCC-CCceeeeccCCCCCCcchHHHHHHhcCCCCCC
Q psy1333           1 MVTQSDTNNVPRAMLMAMFINGLTNEETIALTKSMVDSGETLSWGPE-GIVVDKHSTGGVGDKVSIPLVPALAACGLKPS   79 (79)
Q Consensus         1 ~~~g~~~~~qiaafL~al~~kGet~~Ei~g~~~am~~~~~~~~~~~~-~~~vD~~gTGGdg~niSt~~a~v~Aa~Gv~Va   79 (79)
                      |++|+++|+|++|||||+++||||++||++|+++||+++.+++|+.. ++++|+|||||||+||||+++|++|++|+||+
T Consensus        26 i~~G~~~d~QiaAfLmAl~~kGeT~eEi~g~t~Am~~~~~~l~~~~~~~~~vD~~gTGGdG~~iSt~~a~ivAa~Gv~Va  105 (405)
T TIGR02644        26 YTNGEIPDYQMSALLMAIYFNGMTDEETAYLTKAMIDSGEVLDLSSLPGPKVDKHSTGGVGDKVSLVLGPIVAACGVKVA  105 (405)
T ss_pred             HHcCCCCHHHHHHHHHHHHHcCCCHHHHHHHHHHHHHhCCcCCCcccCCCeeEEeCCCCCCCCchHHHHHHHHhCCCCEE
Confidence            57899999999999999999999999999999999999999999742 45899999999999999999999999999985



In general, members of this protein family are designated pyrimidine-nucleoside phosphorylase, enzyme family EC 2.4.2.2, as in Bacillus subtilis, and more narrowly as the enzyme family EC 2.4.2.4, thymidine phosphorylase (alternate name: pyrimidine phosphorylase), as in Escherichia coli. The set of proteins encompassed by this model is designated subfamily rather than equivalog for this reason; the protein name from this model should be used when TIGR02643 does not score above trusted cutoff.

>TIGR02643 T_phosphoryl thymidine phosphorylase Back     alignment and domain information
>PRK05820 deoA thymidine phosphorylase; Reviewed Back     alignment and domain information
>COG0547 TrpD Anthranilate phosphoribosyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06078 pyrimidine-nucleoside phosphorylase; Reviewed Back     alignment and domain information
>PRK04350 thymidine phosphorylase; Provisional Back     alignment and domain information
>PRK07394 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01245 trpD anthranilate phosphoribosyltransferase Back     alignment and domain information
>TIGR03327 AMP_phos AMP phosphorylase Back     alignment and domain information
>PRK08136 glycosyl transferase family protein; Provisional Back     alignment and domain information
>PRK09522 bifunctional glutamine amidotransferase/anthranilate phosphoribosyltransferase; Provisional Back     alignment and domain information
>TIGR02645 ARCH_P_rylase putative thymidine phosphorylase Back     alignment and domain information
>PLN02641 anthranilate phosphoribosyltransferase Back     alignment and domain information
>PRK14607 bifunctional glutamine amidotransferase/anthranilate phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK00188 trpD anthranilate phosphoribosyltransferase; Provisional Back     alignment and domain information
>COG0213 DeoA Thymidine phosphorylase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK09071 hypothetical protein; Validated Back     alignment and domain information
>PF02885 Glycos_trans_3N: Glycosyl transferase family, helical bundle domain Prosite entry for Thymidine and pyrimidine-nucleoside phosphorylases; InterPro: IPR017459 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases Back     alignment and domain information
>PF00591 Glycos_transf_3: Glycosyl transferase family, a/b domain Prosite entry for Thymidine and pyrimidine-nucleoside phosphorylases; InterPro: IPR000312 The glycosyl transferase family includes anthranilate phosphoribosyltransferase (TrpD, 2 Back     alignment and domain information
>KOG1438|consensus Back     alignment and domain information
>PF02885 Glycos_trans_3N: Glycosyl transferase family, helical bundle domain Prosite entry for Thymidine and pyrimidine-nucleoside phosphorylases; InterPro: IPR017459 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query79
2wk5_A 482 Structural Features Of Native Human Thymidine Phosp 9e-15
2j0f_A 482 Structural Basis For Non-Competitive Product Inhibi 1e-14
1uou_A 474 Crystal Structure Of Human Thymidine Phosphorylase 1e-14
1brw_B 433 The Crystal Structure Of Pyrimidine Nucleoside Phos 3e-11
1azy_A 440 Structural And Theoretical Studies Suggest Domain M 1e-10
2dsj_A 423 Crystal Structure Of Project Id Tt0128 From Thermus 2e-10
3h5q_A 436 Crystal Structure Of A Putative Pyrimidine-Nucleosi 2e-06
>pdb|2WK5|A Chain A, Structural Features Of Native Human Thymidine Phosphorylase And In Complex With 5-Iodouracil Length = 482 Back     alignment and structure

Iteration: 1

Score = 75.1 bits (183), Expect = 9e-15, Method: Compositional matrix adjust. Identities = 40/68 (58%), Positives = 49/68 (72%), Gaps = 4/68 (5%) Query: 13 AMLMAMFINGLTNEETIALTKSMVDSGETLSWGPEG---IVVDKHSTGGVGDKVSIPLVP 69 AMLMA+ + G+ EET LT+++ SG+ L W PE +VDKHSTGGVGDKVS+ L P Sbjct: 73 AMLMAIRLRGMDLEETSVLTQALAQSGQQLEW-PEAWRQQLVDKHSTGGVGDKVSLVLAP 131 Query: 70 ALAACGLK 77 ALAACG K Sbjct: 132 ALAACGCK 139
>pdb|2J0F|A Chain A, Structural Basis For Non-Competitive Product Inhibition In Human Thymidine Phosphorylase: Implication For Drug Design Length = 482 Back     alignment and structure
>pdb|1UOU|A Chain A, Crystal Structure Of Human Thymidine Phosphorylase In Complex With A Small Molecule Inhibitor Length = 474 Back     alignment and structure
>pdb|1BRW|B Chain B, The Crystal Structure Of Pyrimidine Nucleoside Phosphorylase In A Closed Conformation Length = 433 Back     alignment and structure
>pdb|1AZY|A Chain A, Structural And Theoretical Studies Suggest Domain Movement Produces An Active Conformation Of Thymidine Phosphorylase Length = 440 Back     alignment and structure
>pdb|2DSJ|A Chain A, Crystal Structure Of Project Id Tt0128 From Thermus Thermophilus Hb8 Length = 423 Back     alignment and structure
>pdb|3H5Q|A Chain A, Crystal Structure Of A Putative Pyrimidine-Nucleoside Phosphorylase From Staphylococcus Aureus Length = 436 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query79
2dsj_A 423 Pyrimidine-nucleoside (thymidine) phosphorylase; p 2e-30
1brw_A 433 PYNP, protein (pyrimidine nucleoside phosphorylase 2e-30
3h5q_A 436 PYNP, pyrimidine-nucleoside phosphorylase; structu 2e-30
1uou_A 474 Thymidine phosphorylase; transferase, glycosyltran 5e-30
2tpt_A 440 Thymidine phosphorylase; transferase, salvage path 7e-30
>2dsj_A Pyrimidine-nucleoside (thymidine) phosphorylase; pyrimidine-nucleoside phosphorylase, structural genomics; 1.80A {Thermus thermophilus} Length = 423 Back     alignment and structure
 Score =  109 bits (274), Expect = 2e-30
 Identities = 34/65 (52%), Positives = 42/65 (64%)

Query: 13  AMLMAMFINGLTNEETIALTKSMVDSGETLSWGPEGIVVDKHSTGGVGDKVSIPLVPALA 72
           A LMA F+ GL  EET+ LT++M  SG+ L        VDKHS+GGVGDKVS+ + P LA
Sbjct: 40  AWLMAAFLRGLDPEETLWLTETMARSGKVLDLSGLPHPVDKHSSGGVGDKVSLVVGPILA 99

Query: 73  ACGLK 77
           A G  
Sbjct: 100 ASGCT 104


>1brw_A PYNP, protein (pyrimidine nucleoside phosphorylase); domain movement, transferase; HET: MES; 2.10A {Geobacillus stearothermophilus} SCOP: a.46.2.1 c.27.1.1 d.41.3.1 Length = 433 Back     alignment and structure
>3h5q_A PYNP, pyrimidine-nucleoside phosphorylase; structural genomics, glycosyltransferase, transferase; HET: MSE THM; 1.94A {Staphylococcus aureus} Length = 436 Back     alignment and structure
>1uou_A Thymidine phosphorylase; transferase, glycosyltransferase, chemotaxis, angiogenesis; HET: CMU; 2.11A {Homo sapiens} SCOP: a.46.2.1 c.27.1.1 d.41.3.1 PDB: 2wk6_A 2wk5_A 2j0f_A Length = 474 Back     alignment and structure
>2tpt_A Thymidine phosphorylase; transferase, salvage pathway; 2.60A {Escherichia coli} SCOP: a.46.2.1 c.27.1.1 d.41.3.1 PDB: 1azy_A 1tpt_A 1otp_A Length = 440 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query79
2dsj_A 423 Pyrimidine-nucleoside (thymidine) phosphorylase; p 99.96
4hkm_A 346 Anthranilate phosphoribosyltransferase; structural 99.96
2elc_A 329 Trp D, anthranilate phosphoribosyltransferase; str 99.96
1khd_A 345 Anthranilate phosphoribosyltransferase; type 3 PRT 99.96
1brw_A 433 PYNP, protein (pyrimidine nucleoside phosphorylase 99.96
3r88_A 377 Anthranilate phosphoribosyltransferase; anthranili 99.95
2tpt_A 440 Thymidine phosphorylase; transferase, salvage path 99.95
1uou_A 474 Thymidine phosphorylase; transferase, glycosyltran 99.95
1vqu_A 374 Anthranilate phosphoribosyltransferase 2; 17130499 99.95
3h5q_A 436 PYNP, pyrimidine-nucleoside phosphorylase; structu 99.95
1o17_A 345 Anthranilate PRT, anthranilate phosphoribosyltrans 99.94
>2dsj_A Pyrimidine-nucleoside (thymidine) phosphorylase; pyrimidine-nucleoside phosphorylase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
Probab=99.96  E-value=3.2e-30  Score=197.89  Aligned_cols=79  Identities=43%  Similarity=0.549  Sum_probs=73.7

Q ss_pred             CCCCCCChHHHHHHHHHHHhcCCCHHHHHHHHHHHHhhCCccCCCCCCCceeeeccCCCCCCcchHHHHHHhcCCCCCC
Q psy1333           1 MVTQSDTNNVPRAMLMAMFINGLTNEETIALTKSMVDSGETLSWGPEGIVVDKHSTGGVGDKVSIPLVPALAACGLKPS   79 (79)
Q Consensus         1 ~~~g~~~~~qiaafL~al~~kGet~~Ei~g~~~am~~~~~~~~~~~~~~~vD~~gTGGdg~niSt~~a~v~Aa~Gv~Va   79 (79)
                      |++|++||+|++|||||+++||||.+||++|+++||+++.+++|+....++|+|||||||+||||+++|++|+||+||+
T Consensus        28 i~~G~~~d~QiaAfL~Al~~kGet~eEiag~a~aM~~~~~~l~~~~~~~~vD~~gTGGdG~niSt~~a~vvAa~Gv~Va  106 (423)
T 2dsj_A           28 YLRDEVPDYQVSAWLMAAFLRGLDPEETLWLTETMARSGKVLDLSGLPHPVDKHSSGGVGDKVSLVVGPILAASGCTFA  106 (423)
T ss_dssp             HHTTCSCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHTSSBCCCCTTSSSBEEEEEESSSCCSTHHHHHHHHHTTTCBEE
T ss_pred             HHcCCCCHHHHHHHHHHHHHhCCCHHHHHHHHHHHHHhCCcCCccccCCceeEecCCCCCccHHHHHHHHHHhCCCcEE
Confidence            5789999999999999999999999999999999999999999874212899999999999999999999999999985



>4hkm_A Anthranilate phosphoribosyltransferase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; HET: MSE CXS; 1.95A {Xanthomonas campestris PV} Back     alignment and structure
>2elc_A Trp D, anthranilate phosphoribosyltransferase; structural genomics, NPPSFA, national project O structural and functional analyses; 1.55A {Thermus thermophilus} SCOP: a.46.2.1 c.27.1.1 PDB: 1v8g_A Back     alignment and structure
>1khd_A Anthranilate phosphoribosyltransferase; type 3 PRT fold, nucleotide binding fold; 1.86A {Pectobacterium carotovorum} SCOP: a.46.2.1 c.27.1.1 PDB: 1kgz_A Back     alignment and structure
>1brw_A PYNP, protein (pyrimidine nucleoside phosphorylase); domain movement, transferase; HET: MES; 2.10A {Geobacillus stearothermophilus} SCOP: a.46.2.1 c.27.1.1 d.41.3.1 Back     alignment and structure
>3r88_A Anthranilate phosphoribosyltransferase; anthranilic acids, M tryptophan, inhibitor, magnesium binding phosp pyrophosphate; HET: PRP 14F; 1.73A {Mycobacterium tuberculosis} PDB: 3qqs_A 3qs8_A* 3qsa_A* 3qr9_A* 3r6c_A* 3twp_A* 1zvw_A* 2bpq_A Back     alignment and structure
>2tpt_A Thymidine phosphorylase; transferase, salvage pathway; 2.60A {Escherichia coli} SCOP: a.46.2.1 c.27.1.1 d.41.3.1 PDB: 1azy_A 1tpt_A 1otp_A Back     alignment and structure
>1uou_A Thymidine phosphorylase; transferase, glycosyltransferase, chemotaxis, angiogenesis; HET: CMU; 2.11A {Homo sapiens} SCOP: a.46.2.1 c.27.1.1 d.41.3.1 PDB: 2wk6_A 2wk5_A 2j0f_A Back     alignment and structure
>1vqu_A Anthranilate phosphoribosyltransferase 2; 17130499, structur genomics, joint center for structural genomics, JCSG, prote structure initiative, PSI; 1.85A {Nostoc SP} Back     alignment and structure
>3h5q_A PYNP, pyrimidine-nucleoside phosphorylase; structural genomics, glycosyltransferase, transferase; HET: MSE THM; 1.94A {Staphylococcus aureus} Back     alignment and structure
>1o17_A Anthranilate PRT, anthranilate phosphoribosyltransferase, TRPD; nucleoside-phosphorylases; 2.05A {Sulfolobus solfataricus} SCOP: a.46.2.1 c.27.1.1 PDB: 1gxb_A 1zxy_A* 1zyk_A* 2gvq_A* 3gbr_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 79
d1uoua2 273 c.27.1.1 (A:101-373) Thymidine phosphorylase {Huma 3e-11
d2tpta2 265 c.27.1.1 (A:71-335) Thymidine phosphorylase {Esche 6e-11
d1brwa2 260 c.27.1.1 (A:71-330) Pyrimidine nucleoside phosphor 6e-11
d2tpta170 a.46.2.1 (A:1-70) Thymidine phosphorylase {Escheri 2e-08
d1uoua168 a.46.2.1 (A:33-100) Thymidine phosphorylase {Human 8e-08
d1brwa170 a.46.2.1 (A:1-70) Pyrimidine nucleoside phosphoryl 8e-08
d1khda2 264 c.27.1.1 (A:81-344) Anthranilate phosphoribosyltra 7e-06
d2elca2 264 c.27.1.1 (A:66-329) Anthranilate phosphoribosyltra 1e-05
d1o17a170 a.46.2.1 (A:1-70) Anthranilate phosphoribosyltrans 2e-05
d1khda169 a.46.2.1 (A:12-80) Anthranilate phosphoribosyltran 3e-05
>d1uoua2 c.27.1.1 (A:101-373) Thymidine phosphorylase {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain
superfamily: Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain
family: Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain
domain: Thymidine phosphorylase
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 54.4 bits (130), Expect = 3e-11
 Identities = 25/38 (65%), Positives = 27/38 (71%), Gaps = 2/38 (5%)

Query: 42 LSW--GPEGIVVDKHSTGGVGDKVSIPLVPALAACGLK 77
          L W       +VDKHSTGGVGDKVS+ L PALAACG K
Sbjct: 2  LEWPEAWRQQLVDKHSTGGVGDKVSLVLAPALAACGCK 39


>d2tpta2 c.27.1.1 (A:71-335) Thymidine phosphorylase {Escherichia coli [TaxId: 562]} Length = 265 Back     information, alignment and structure
>d1brwa2 c.27.1.1 (A:71-330) Pyrimidine nucleoside phosphorylase {Bacillus stearothermophilus [TaxId: 1422]} Length = 260 Back     information, alignment and structure
>d2tpta1 a.46.2.1 (A:1-70) Thymidine phosphorylase {Escherichia coli [TaxId: 562]} Length = 70 Back     information, alignment and structure
>d1uoua1 a.46.2.1 (A:33-100) Thymidine phosphorylase {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d1brwa1 a.46.2.1 (A:1-70) Pyrimidine nucleoside phosphorylase {Bacillus stearothermophilus [TaxId: 1422]} Length = 70 Back     information, alignment and structure
>d1khda2 c.27.1.1 (A:81-344) Anthranilate phosphoribosyltransferase (TrpD) {Pectobacterium carotovorum [TaxId: 554]} Length = 264 Back     information, alignment and structure
>d2elca2 c.27.1.1 (A:66-329) Anthranilate phosphoribosyltransferase (TrpD) {Thermus thermophilus [TaxId: 274]} Length = 264 Back     information, alignment and structure
>d1o17a1 a.46.2.1 (A:1-70) Anthranilate phosphoribosyltransferase (TrpD) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 70 Back     information, alignment and structure
>d1khda1 a.46.2.1 (A:12-80) Anthranilate phosphoribosyltransferase (TrpD) {Pectobacterium carotovorum [TaxId: 554]} Length = 69 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query79
d1khda169 Anthranilate phosphoribosyltransferase (TrpD) {Pec 99.63
d1brwa170 Pyrimidine nucleoside phosphorylase {Bacillus stea 99.6
d1o17a170 Anthranilate phosphoribosyltransferase (TrpD) {Arc 99.6
d1uoua2 273 Thymidine phosphorylase {Human (Homo sapiens) [Tax 99.59
d2tpta170 Thymidine phosphorylase {Escherichia coli [TaxId: 99.57
d1uoua168 Thymidine phosphorylase {Human (Homo sapiens) [Tax 99.55
d2tpta2 265 Thymidine phosphorylase {Escherichia coli [TaxId: 99.54
d1brwa2 260 Pyrimidine nucleoside phosphorylase {Bacillus stea 99.5
d2elca2 264 Anthranilate phosphoribosyltransferase (TrpD) {The 99.42
d1khda2 264 Anthranilate phosphoribosyltransferase (TrpD) {Pec 99.38
d1o17a2 273 Anthranilate phosphoribosyltransferase (TrpD) {Arc 99.11
d2elca152 Anthranilate phosphoribosyltransferase (TrpD) {The 99.11
d1byia_ 224 Dethiobiotin synthetase {Escherichia coli [TaxId: 90.33
d1o17a170 Anthranilate phosphoribosyltransferase (TrpD) {Arc 86.57
d1brwa170 Pyrimidine nucleoside phosphorylase {Bacillus stea 86.47
d1uoua168 Thymidine phosphorylase {Human (Homo sapiens) [Tax 86.32
d2tpta170 Thymidine phosphorylase {Escherichia coli [TaxId: 85.55
d1khda169 Anthranilate phosphoribosyltransferase (TrpD) {Pec 84.96
d2elca152 Anthranilate phosphoribosyltransferase (TrpD) {The 84.93
d1ihua2 279 Arsenite-translocating ATPase ArsA {Escherichia co 81.47
>d1khda1 a.46.2.1 (A:12-80) Anthranilate phosphoribosyltransferase (TrpD) {Pectobacterium carotovorum [TaxId: 554]} Back     information, alignment and structure
class: All alpha proteins
fold: Methionine synthase domain-like
superfamily: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain
family: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain
domain: Anthranilate phosphoribosyltransferase (TrpD)
species: Pectobacterium carotovorum [TaxId: 554]
Probab=99.63  E-value=1.5e-16  Score=93.34  Aligned_cols=43  Identities=16%  Similarity=0.247  Sum_probs=41.2

Q ss_pred             CCCCCCChHHHHHHHHHHHhcCCCHHHHHHHHHHHHhhCCccC
Q psy1333           1 MVTQSDTNNVPRAMLMAMFINGLTNEETIALTKSMVDSGETLS   43 (79)
Q Consensus         1 ~~~g~~~~~qiaafL~al~~kGet~~Ei~g~~~am~~~~~~~~   43 (79)
                      |++|+++|.|++|||++++.||||.+||++|+++||+++.++|
T Consensus        27 i~~g~~~d~qiaafL~al~~kg~t~dEi~g~~~am~~~~~~~P   69 (69)
T d1khda1          27 IVRGELEDSQLAAALISMKMRGERPEEIAGAASALLADAQPFP   69 (69)
T ss_dssp             HTTTCSCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHTSCCCC
T ss_pred             HHcCCCCHHHHHHHHHHHHHhCCCHHHHHHHHHHHHHhCCCCC
Confidence            5799999999999999999999999999999999999999875



>d1brwa1 a.46.2.1 (A:1-70) Pyrimidine nucleoside phosphorylase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1o17a1 a.46.2.1 (A:1-70) Anthranilate phosphoribosyltransferase (TrpD) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1uoua2 c.27.1.1 (A:101-373) Thymidine phosphorylase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2tpta1 a.46.2.1 (A:1-70) Thymidine phosphorylase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uoua1 a.46.2.1 (A:33-100) Thymidine phosphorylase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2tpta2 c.27.1.1 (A:71-335) Thymidine phosphorylase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1brwa2 c.27.1.1 (A:71-330) Pyrimidine nucleoside phosphorylase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2elca2 c.27.1.1 (A:66-329) Anthranilate phosphoribosyltransferase (TrpD) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1khda2 c.27.1.1 (A:81-344) Anthranilate phosphoribosyltransferase (TrpD) {Pectobacterium carotovorum [TaxId: 554]} Back     information, alignment and structure
>d1o17a2 c.27.1.1 (A:71-343) Anthranilate phosphoribosyltransferase (TrpD) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2elca1 a.46.2.1 (A:1-52) Anthranilate phosphoribosyltransferase (TrpD) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1o17a1 a.46.2.1 (A:1-70) Anthranilate phosphoribosyltransferase (TrpD) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1brwa1 a.46.2.1 (A:1-70) Pyrimidine nucleoside phosphorylase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1uoua1 a.46.2.1 (A:33-100) Thymidine phosphorylase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2tpta1 a.46.2.1 (A:1-70) Thymidine phosphorylase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1khda1 a.46.2.1 (A:12-80) Anthranilate phosphoribosyltransferase (TrpD) {Pectobacterium carotovorum [TaxId: 554]} Back     information, alignment and structure
>d2elca1 a.46.2.1 (A:1-52) Anthranilate phosphoribosyltransferase (TrpD) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure