Diaphorina citri psyllid: psy13340

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-
MEHIPKTLTPNGIIDSAPKKFAVWGLREKYDENPTLLGEFMYDSEGPTLQYFEAKMVADTFDMVELKILSNHGNIEYTCLYRFRVHGNLAPSPSPVHTYNRFSSANHNTLHHMTSSKYNPV
cccccccccccccccccccEEEEEEECccccccccEEEEEEEccccccEEEEEEccccccccEEEEEEEcccccccccEEEEEEECccccccccccccccccccccccccCEECccccccc
**HIPKT*****IIDSAPKKFAVWGLREKYDENPTLLGEFMYDSEGPTLQYFEAKMVADTFDMVELKILSNHGNIEYTCLYRFRVHGNLA********************HHMT*******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEHIPKTLTPNGIIDSAPKKFAVWGLREKYDENPTLLGEFMYDSEGPTLQYFEAKMVADTFDMVELKILSNHGNIEYTCLYRFRVHGNLAPSPSPVHTYNRFSSANHNTLHHMTSSKYNPV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005521 [MF]lamin bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0090292 [BP]nuclear matrix anchoring at nuclear membraneprobableGO:0034504, GO:0008104, GO:0051651, GO:0071840, GO:0070727, GO:0051457, GO:0016043, GO:0065007, GO:0044699, GO:0033036, GO:0034613, GO:0032507, GO:0072595, GO:0009987, GO:0045185, GO:0043578, GO:0044763, GO:0051235, GO:0051179, GO:0051641, GO:0006996, GO:0006997, GO:0065008, GO:0033365, GO:0008150
GO:0034993 [CC]SUN-KASH complexprobableGO:0043234, GO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0005635, GO:0044464, GO:0031967, GO:0005622, GO:0044446, GO:0043229, GO:0044428, GO:0034992, GO:0044424, GO:0005623, GO:0031975, GO:0043227, GO:0043226, GO:0044422, GO:0012505
GO:0090286 [BP]cytoskeletal anchoring at nuclear membraneprobableGO:0006996, GO:0033036, GO:0008104, GO:0007010, GO:0032507, GO:0070727, GO:0009987, GO:0034613, GO:0016043, GO:0045185, GO:0065007, GO:0044763, GO:0071840, GO:0008150, GO:0051235, GO:0065008, GO:0051651, GO:0051179, GO:0044699, GO:0051641
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0042802 [MF]identical protein bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0005639 [CC]integral to nuclear inner membraneprobableGO:0016020, GO:0044464, GO:0031975, GO:0043229, GO:0031229, GO:0031301, GO:0031300, GO:0043227, GO:0043226, GO:0031224, GO:0005575, GO:0031090, GO:0005637, GO:0016021, GO:0005635, GO:0044453, GO:0031965, GO:0031967, GO:0012505, GO:0043231, GO:0019866, GO:0005623, GO:0005622, GO:0044446, GO:0044428, GO:0044424, GO:0044425, GO:0005634, GO:0044422
GO:0005815 [CC]microtubule organizing centerprobableGO:0005856, GO:0005575, GO:0015630, GO:0043228, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043226, GO:0044422
GO:0002080 [CC]acrosomal membraneprobableGO:0043229, GO:0001669, GO:0043227, GO:0043226, GO:0005737, GO:0005575, GO:0030667, GO:0031090, GO:0016023, GO:0031410, GO:0016020, GO:0031988, GO:0044433, GO:0030141, GO:0030659, GO:0012505, GO:0012506, GO:0031982, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044424, GO:0044422
GO:0005819 [CC]spindleprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0006998 [BP]nuclear envelope organizationprobableGO:0006996, GO:0006997, GO:0016044, GO:0009987, GO:0016043, GO:0061024, GO:0044763, GO:0071840, GO:0008150, GO:0044699
GO:0007097 [BP]nuclear migrationprobableGO:0051234, GO:0040023, GO:0009987, GO:0008150, GO:0044763, GO:0044699, GO:0051649, GO:0051647, GO:0051656, GO:0051179, GO:0051640, GO:0051641

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4DXT, chain A
Confidence level:very confident
Coverage over the Query: 1-90
View the alignment between query and template
View the model in PyMOL