Diaphorina citri psyllid: psy13344

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-----
MTGLCDANSRFFKSNKKQFPMFPFHETKIKYDEYGNHSSWAYGEEIFTGPIWKIVKEGEEEIVYGVDFNLKKERHLNGCVLDRFIRPTVVITDTMSAIYQQARRRTRDERLMTNILQTLRNNGNVLVAVDTAGRVLELTHMLEQLWRNKDSGLVS
ccccccccHHHHHHHHccccEEEcccEEEEccccccEEEEccccccccccEEEEEEEccEEEEEECccccccccccccccccccccccEEEEEccccccccccHHHHHHHHHHHHHHHHHcccEEEEEccccHHHHHHHHHHHHHHHcccccccc
*******NSRFFKSNKKQFPMFPFHETKIKYDEYGNHSSWAYGEEIFTGPIWKIVKEGEEEIVYGVDFNLKKERHLNGCVLDRFIRPTVVITDTMSAIYQQARRRTRDERLMTNILQTLRNNGNVLVAVDTAGRVLELTHMLEQLWRNKDSGL**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTGLCDANSRFFKSNKKQFPMFPFHETKIKYDEYGNHSSWAYGEEIFTGPIWKIVKEGEEEIVYGVDFNLKKERHLNGCVLDRFIRPTVVITDTMSAIYQQARRRTRDERLMTNILQTLRNNGNVLVAVDTAGRVLELTHMLEQLWRNKDSGLVS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Cleavage and polyadenylation specificity factor subunit 2 Component of the cleavage and polyadenylation specificity factor (CPSF) complex that play a key role in pre-mRNA 3'-end formation, recognizing the AAUAAA signal sequence and interacting with poly(A) polymerase and other factors to bring about cleavage and poly(A) addition. Involved in the histone 3' end pre-mRNA processing.confidentO35218
Cleavage and polyadenylation specificity factor subunit 2 CPSF plays a key role in pre-mRNA 3'-end formation, recognizing the AAUAAA signal sequence and interacting with poly(A)polymerase and other factors to bring about cleavage and poly(A) addition.confidentQ9LKF9
Cleavage and polyadenylation specificity factor subunit 2 Component of the cleavage and polyadenylation specificity factor (CPSF) complex that play a key role in pre-mRNA 3'-end formation, recognizing the AAUAAA signal sequence and interacting with poly(A) polymerase and other factors to bring about cleavage and poly(A) addition. Involved in the histone 3' end pre-mRNA processing.confidentQ9P2I0

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044763 [BP]single-organism cellular processprobableGO:0009987, GO:0008150, GO:0044699
GO:0006398 [BP]histone mRNA 3'-end processingprobableGO:0008334, GO:0090304, GO:0034641, GO:0006807, GO:1901360, GO:0006139, GO:0044260, GO:0071704, GO:0010467, GO:0044238, GO:0031124, GO:0009987, GO:0006725, GO:0031123, GO:0008150, GO:0008152, GO:0046483, GO:0016070, GO:0016071, GO:0044237, GO:0043170, GO:0006396, GO:0006397
GO:0009506 [CC]plasmodesmaprobableGO:0055044, GO:0005575, GO:0030054, GO:0005911
GO:0005847 [CC]mRNA cleavage and polyadenylation specificity factor complexprobableGO:0005849, GO:0031974, GO:0043229, GO:0043227, GO:0043226, GO:0005575, GO:0031981, GO:0005634, GO:0005654, GO:0044451, GO:0043234, GO:0032991, GO:0043231, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0070013, GO:0044428, GO:0044424, GO:0044422

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2YCB, chain A
Confidence level:very confident
Coverage over the Query: 19-150
View the alignment between query and template
View the model in PyMOL