Diaphorina citri psyllid: psy13346

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------24

MSTKQRASVPNQGKHQVCPKPSSRSYDGVPVMKPTDVSTEKTSRKRKHSDKTTRTPDDSPVTECHDSSPVKIRREHASTFVASEDIAVKRKLDILKRSTLRPIVIYYEPKDAKLPSQYKWRLYPFKNHQPLPIMYIHRQSAYIIGRNAKVSDILIRHCSCSNQHAVLQYRELSLNNTRVVRPYLMDLKSMNGTFVNGMKIAPLTYVELFEGDVIEFGLSTREYVLLHQNSECLQRNVT

cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHcccccccccccccccccccccccccEEEEEEcccccccEEEEccccEEEEccccccccEEEcccccccccEEEEEEEccccccccEEEEEEEccccccCEEccCEcccccEEEcccccEEEEcccccEEEEEcccccccccccc

************************************************************************************************RSTLRPIVIYYEPKDAKLPSQYKWRLYPFKNHQPLPIMYIHRQSAYIIGRNAKVSDILIRHCSCSNQHAVLQYRELSLNNTRVVRPYLMDLKSMNGTFVNGMKIAPLTYVELFEGDVIEFGLSTREYVLLHQ**********

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Smad nuclear interacting protein 1	Down-regulates NF-kappa-B signaling by competing with RELA for CREBBP/EP300 binding. Involved in the microRNA (miRNA) biogenesis.	confident	Q5M9G6
Smad nuclear-interacting protein 1	Down-regulates NF-kappa-B signaling by competing with RELA for CREBBP/EP300 binding. Involved in the microRNA (miRNA) biogenesis.	confident	Q8TAD8
Smad nuclear-interacting protein 1	Down-regulates NF-kappa-B signaling by competing with RELA for CREBBP/EP300 binding. Involved in the microRNA (miRNA) biogenesis.	confident	Q8BIZ6

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005829 [CC]	cytosol	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005515 [MF]	protein binding	probable	GO:0003674, GO:0005488
GO:0006396 [BP]	RNA processing	probable	GO:0016070, GO:0006139, GO:0044260, GO:0044238, GO:0009987, GO:0006725, GO:0034641, GO:0044237, GO:0043170, GO:0090304, GO:0071704, GO:0010467, GO:0006807, GO:0008150, GO:0008152, GO:1901360, GO:0046483
GO:0006355 [BP]	regulation of transcription, DNA-dependent	probable	GO:0009889, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:2000112, GO:0050794, GO:0050789, GO:0019219, GO:0010556, GO:0065007, GO:0051171, GO:2001141, GO:0008150, GO:0010468
GO:0005730 [CC]	nucleolus	probable	GO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0009507 [CC]	chloroplast	probable	GO:0005737, GO:0009536, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0007249 [BP]	I-kappaB kinase/NF-kappaB cascade	probable	GO:0044700, GO:0051716, GO:0007243, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0035556, GO:0050789, GO:0044699

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3ELV, chain A
Confidence level:very confident
Coverage over the Query: 105-219
View the alignment between query and template
View the model in PyMOL